Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HQ78

Protein Details
Accession A0A443HQ78    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAASTGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
9-24GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAASTGGKKQKKKWSKGKVKDKANHAVVLDKTTSEKLYKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKMNIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.86
5 0.91
6 0.93
7 0.92
8 0.92
9 0.88
10 0.84
11 0.82
12 0.74
13 0.66
14 0.55
15 0.5
16 0.41
17 0.36
18 0.29
19 0.2
20 0.18
21 0.16
22 0.17
23 0.13
24 0.13
25 0.13
26 0.19
27 0.21
28 0.24
29 0.25
30 0.28
31 0.31
32 0.32
33 0.29
34 0.24
35 0.22
36 0.17
37 0.16
38 0.13
39 0.08
40 0.09
41 0.08
42 0.09
43 0.09
44 0.1
45 0.1
46 0.09
47 0.1
48 0.12
49 0.15
50 0.16
51 0.16
52 0.17
53 0.16
54 0.16
55 0.17
56 0.15
57 0.15
58 0.13
59 0.15
60 0.2
61 0.21
62 0.21
63 0.23
64 0.22
65 0.21
66 0.25
67 0.31
68 0.35
69 0.39
70 0.44
71 0.44
72 0.51
73 0.57
74 0.54
75 0.49
76 0.42
77 0.4