Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443HT04

Protein Details
Accession A0A443HT04    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-73AERYERAKRNRDKARENRKRIEQIWBasic
NLS Segment(s)
PositionSequence
54-68RAKRNRDKARENRKR
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSHLHTPENANCEEIMTMLDECHARGFLWKAMGQCSDIKVQVNKCLGAERYERAKRNRDKARENRKRIEQIWAEERVREGVVAPADTTSAATGSAETKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.12
4 0.09
5 0.09
6 0.07
7 0.09
8 0.08
9 0.09
10 0.09
11 0.09
12 0.08
13 0.1
14 0.13
15 0.13
16 0.16
17 0.18
18 0.18
19 0.2
20 0.21
21 0.2
22 0.18
23 0.18
24 0.17
25 0.16
26 0.18
27 0.19
28 0.2
29 0.24
30 0.24
31 0.22
32 0.2
33 0.22
34 0.2
35 0.2
36 0.2
37 0.17
38 0.24
39 0.29
40 0.35
41 0.37
42 0.46
43 0.5
44 0.58
45 0.65
46 0.65
47 0.7
48 0.75
49 0.82
50 0.83
51 0.84
52 0.82
53 0.81
54 0.8
55 0.71
56 0.7
57 0.63
58 0.58
59 0.55
60 0.54
61 0.46
62 0.39
63 0.39
64 0.31
65 0.26
66 0.2
67 0.16
68 0.13
69 0.14
70 0.14
71 0.13
72 0.11
73 0.11
74 0.11
75 0.11
76 0.08
77 0.06
78 0.06
79 0.06
80 0.07