Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A443I3R7

Protein Details
Accession A0A443I3R7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
134-156LDETPTPTPKRQRKKGTAVKVGSHydrophilic
NLS Segment(s)
PositionSequence
101-109KKGTPKRKK
143-163KRQRKKGTAVKVGSPKKTTKT
Subcellular Location(s) cyto 16.5, cyto_mito 9.5, nucl 4, extr 3
Family & Domain DBs
Amino Acid Sequences MSSPSTAKNELVLGLTASEAKILILGMVSTTDGKVDYQLLAQKGGYKTKDSAATVYNGARRKLLKLHGDSSASATTGGAKSKTLAANEGENDESTATPASKKGTPKRKKATPAITDNNETPDSNLPTDAQLNDLDETPTPTPKRQRKKGTAVKVGSPKKTTKTSKVKAEETGKHETLDDMGNPLPSLELDAEDRALSADLDRFLKSEGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.08
6 0.07
7 0.06
8 0.06
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.09
23 0.09
24 0.11
25 0.15
26 0.16
27 0.16
28 0.16
29 0.21
30 0.23
31 0.29
32 0.28
33 0.26
34 0.27
35 0.3
36 0.35
37 0.3
38 0.29
39 0.25
40 0.25
41 0.24
42 0.26
43 0.27
44 0.26
45 0.25
46 0.26
47 0.25
48 0.26
49 0.3
50 0.34
51 0.37
52 0.38
53 0.4
54 0.4
55 0.4
56 0.38
57 0.35
58 0.28
59 0.21
60 0.16
61 0.13
62 0.11
63 0.11
64 0.12
65 0.09
66 0.09
67 0.09
68 0.13
69 0.15
70 0.14
71 0.15
72 0.14
73 0.16
74 0.17
75 0.17
76 0.14
77 0.12
78 0.12
79 0.1
80 0.09
81 0.07
82 0.07
83 0.06
84 0.06
85 0.07
86 0.09
87 0.12
88 0.19
89 0.27
90 0.38
91 0.46
92 0.55
93 0.63
94 0.68
95 0.72
96 0.74
97 0.75
98 0.71
99 0.71
100 0.67
101 0.62
102 0.57
103 0.5
104 0.45
105 0.36
106 0.29
107 0.22
108 0.19
109 0.18
110 0.16
111 0.16
112 0.13
113 0.13
114 0.15
115 0.13
116 0.11
117 0.09
118 0.1
119 0.1
120 0.1
121 0.1
122 0.09
123 0.12
124 0.11
125 0.17
126 0.17
127 0.22
128 0.31
129 0.4
130 0.51
131 0.58
132 0.67
133 0.71
134 0.81
135 0.86
136 0.86
137 0.86
138 0.79
139 0.76
140 0.75
141 0.72
142 0.66
143 0.6
144 0.54
145 0.5
146 0.56
147 0.56
148 0.57
149 0.61
150 0.64
151 0.7
152 0.73
153 0.71
154 0.7
155 0.72
156 0.69
157 0.63
158 0.63
159 0.54
160 0.47
161 0.44
162 0.36
163 0.29
164 0.24
165 0.19
166 0.14
167 0.14
168 0.14
169 0.13
170 0.13
171 0.11
172 0.09
173 0.11
174 0.09
175 0.09
176 0.11
177 0.12
178 0.13
179 0.12
180 0.12
181 0.11
182 0.11
183 0.09
184 0.09
185 0.11
186 0.13
187 0.15
188 0.15
189 0.15