Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A443HX28

Protein Details
Accession A0A443HX28    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
143-168SSEGHKKIYKNRFNADRKKQSHKEGWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15.666, nucl 14.5, cyto 10.5, mito_nucl 9.331, cyto_mito 7.331
Family & Domain DBs
InterPro View protein in InterPro  
IPR042098  TauD-like_sf  
IPR003819  TauD/TfdA-like  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF02668  TauD  
Amino Acid Sequences MAPSAQVENPATPPTTIPVGKAAPAASETLQRQPLKLSGVLDQYESFDVTPVIGREFPKANLKEWLRAPNSDELIRELAITVSRRGVVFFRAQDDLDNDTQKELAQRLGELSGKPSTSGLHIHPVSNSQREYGDKDNEISVISSEGHKKIYKNRFNADRKKQSHKEGWHSDITFEPVPSDYAILRLTELPKTGGGEYSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.21
4 0.2
5 0.23
6 0.23
7 0.23
8 0.24
9 0.21
10 0.16
11 0.17
12 0.18
13 0.13
14 0.18
15 0.19
16 0.23
17 0.3
18 0.29
19 0.29
20 0.3
21 0.31
22 0.29
23 0.29
24 0.25
25 0.22
26 0.26
27 0.25
28 0.24
29 0.22
30 0.2
31 0.18
32 0.17
33 0.13
34 0.1
35 0.09
36 0.08
37 0.09
38 0.08
39 0.09
40 0.11
41 0.12
42 0.15
43 0.17
44 0.19
45 0.26
46 0.27
47 0.27
48 0.33
49 0.34
50 0.37
51 0.39
52 0.44
53 0.38
54 0.37
55 0.38
56 0.35
57 0.36
58 0.31
59 0.28
60 0.22
61 0.21
62 0.2
63 0.17
64 0.11
65 0.09
66 0.1
67 0.11
68 0.09
69 0.09
70 0.1
71 0.1
72 0.1
73 0.11
74 0.11
75 0.13
76 0.13
77 0.15
78 0.15
79 0.15
80 0.15
81 0.16
82 0.17
83 0.16
84 0.16
85 0.13
86 0.12
87 0.12
88 0.12
89 0.11
90 0.09
91 0.09
92 0.08
93 0.08
94 0.09
95 0.1
96 0.11
97 0.1
98 0.12
99 0.11
100 0.11
101 0.11
102 0.11
103 0.1
104 0.1
105 0.13
106 0.11
107 0.17
108 0.18
109 0.18
110 0.18
111 0.23
112 0.24
113 0.26
114 0.25
115 0.19
116 0.2
117 0.22
118 0.26
119 0.26
120 0.27
121 0.25
122 0.25
123 0.25
124 0.23
125 0.22
126 0.17
127 0.12
128 0.09
129 0.09
130 0.1
131 0.13
132 0.13
133 0.16
134 0.19
135 0.21
136 0.3
137 0.4
138 0.46
139 0.5
140 0.57
141 0.65
142 0.72
143 0.8
144 0.81
145 0.81
146 0.79
147 0.83
148 0.82
149 0.8
150 0.79
151 0.77
152 0.77
153 0.74
154 0.73
155 0.7
156 0.63
157 0.56
158 0.48
159 0.45
160 0.36
161 0.28
162 0.24
163 0.17
164 0.18
165 0.17
166 0.16
167 0.11
168 0.12
169 0.13
170 0.12
171 0.13
172 0.15
173 0.17
174 0.18
175 0.2
176 0.19
177 0.2
178 0.22
179 0.21