Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A2A1

Protein Details
Accession A0A437A2A1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRGQPKRQHHKYYKFHKSQALGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 9.333, nucl 8.5, cyto_nucl 7.333, cyto 5
Family & Domain DBs
Amino Acid Sequences MRGQPKRQHHKYYKFHKSQALGIPMARTQILPGMGTIPVQYPVQYPAQHPAQYPIQYPPQNLAPNPIQHPPQYPGQYPMQQYPVHQNPEQDLAQPTSMAPCACATCRSATGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.8
4 0.73
5 0.69
6 0.66
7 0.6
8 0.5
9 0.43
10 0.39
11 0.32
12 0.3
13 0.23
14 0.15
15 0.1
16 0.12
17 0.12
18 0.1
19 0.1
20 0.1
21 0.09
22 0.1
23 0.1
24 0.07
25 0.08
26 0.08
27 0.08
28 0.08
29 0.1
30 0.14
31 0.14
32 0.15
33 0.18
34 0.22
35 0.23
36 0.22
37 0.23
38 0.24
39 0.24
40 0.25
41 0.23
42 0.25
43 0.26
44 0.26
45 0.24
46 0.25
47 0.26
48 0.25
49 0.26
50 0.22
51 0.24
52 0.26
53 0.27
54 0.23
55 0.23
56 0.26
57 0.24
58 0.28
59 0.29
60 0.27
61 0.29
62 0.32
63 0.35
64 0.34
65 0.34
66 0.32
67 0.29
68 0.3
69 0.35
70 0.37
71 0.38
72 0.37
73 0.35
74 0.33
75 0.38
76 0.37
77 0.3
78 0.26
79 0.23
80 0.22
81 0.21
82 0.19
83 0.16
84 0.17
85 0.15
86 0.13
87 0.12
88 0.15
89 0.16
90 0.18
91 0.18
92 0.2