Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437A9H7

Protein Details
Accession A0A437A9H7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
109-134VAKLVRSMTKKHKEKKEQQQNNGADGHydrophilic
NLS Segment(s)
PositionSequence
119-119K
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 11.999, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCRYRKYIFVNCGHSEFESPPYLPCVSDPNEYCSPETTSDPPITLKKNTACSDPACAGLGGGLSSPTGPTDGGTSWSRTNSGNRGRALGPGEGDPGDRLRHTVSTKMKVAKLVRSMTKKHKEKKEQQQNNGADGFLPDNQGSYNEINEMDELKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.33
4 0.29
5 0.25
6 0.22
7 0.21
8 0.23
9 0.22
10 0.19
11 0.19
12 0.2
13 0.21
14 0.27
15 0.28
16 0.31
17 0.35
18 0.36
19 0.36
20 0.33
21 0.32
22 0.27
23 0.29
24 0.25
25 0.24
26 0.23
27 0.23
28 0.24
29 0.25
30 0.27
31 0.25
32 0.28
33 0.29
34 0.36
35 0.36
36 0.36
37 0.35
38 0.32
39 0.34
40 0.3
41 0.27
42 0.19
43 0.18
44 0.14
45 0.12
46 0.1
47 0.06
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.09
60 0.1
61 0.12
62 0.12
63 0.13
64 0.14
65 0.14
66 0.16
67 0.2
68 0.26
69 0.3
70 0.29
71 0.32
72 0.31
73 0.32
74 0.32
75 0.25
76 0.19
77 0.14
78 0.14
79 0.12
80 0.12
81 0.1
82 0.09
83 0.1
84 0.09
85 0.09
86 0.1
87 0.14
88 0.15
89 0.22
90 0.27
91 0.32
92 0.37
93 0.4
94 0.4
95 0.42
96 0.44
97 0.42
98 0.42
99 0.42
100 0.45
101 0.46
102 0.51
103 0.56
104 0.63
105 0.67
106 0.7
107 0.75
108 0.79
109 0.84
110 0.89
111 0.9
112 0.89
113 0.88
114 0.89
115 0.81
116 0.74
117 0.64
118 0.52
119 0.41
120 0.32
121 0.26
122 0.17
123 0.17
124 0.12
125 0.12
126 0.12
127 0.13
128 0.15
129 0.14
130 0.15
131 0.14
132 0.14
133 0.15
134 0.15