Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AGY9

Protein Details
Accession A0A437AGY9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-26WNPNWRCFPRRRAVGGRKKLKARHydrophilic
NLS Segment(s)
PositionSequence
13-25RRRAVGGRKKLKA
Subcellular Location(s) plas 14, mito 6, nucl 3.5, cyto_nucl 2.5, E.R. 2
Family & Domain DBs
Amino Acid Sequences MFSWNPNWRCFPRRRAVGGRKKLKARSLADLETWFSGLVRILCVLLIHTGQQPQGSPKLPGADIDSRNFVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.79
4 0.81
5 0.84
6 0.84
7 0.81
8 0.8
9 0.77
10 0.72
11 0.7
12 0.62
13 0.59
14 0.55
15 0.49
16 0.44
17 0.39
18 0.34
19 0.26
20 0.22
21 0.14
22 0.09
23 0.08
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.08
36 0.09
37 0.1
38 0.11
39 0.11
40 0.14
41 0.19
42 0.19
43 0.2
44 0.21
45 0.24
46 0.23
47 0.24
48 0.27
49 0.3
50 0.31
51 0.33
52 0.34