Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZY63

Protein Details
Accession A0A436ZY63    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
75-95DLGAVRKVRHRKEFNRPPKAABasic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 6, cyto 5, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MSQRRRCILSTWLDFNIPIPCKHCRRNGGTTSISGSWVKETCSCPIHTHCNANDSRDGGLGVAVCGLDSLAAEWDLGAVRKVRHRKEFNRPPKAALAALRYGIPSADRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.37
4 0.3
5 0.25
6 0.24
7 0.3
8 0.37
9 0.43
10 0.49
11 0.5
12 0.55
13 0.62
14 0.64
15 0.63
16 0.58
17 0.53
18 0.48
19 0.41
20 0.35
21 0.27
22 0.22
23 0.17
24 0.16
25 0.16
26 0.16
27 0.18
28 0.19
29 0.21
30 0.22
31 0.23
32 0.26
33 0.32
34 0.31
35 0.34
36 0.31
37 0.35
38 0.33
39 0.32
40 0.3
41 0.23
42 0.21
43 0.16
44 0.15
45 0.09
46 0.09
47 0.07
48 0.05
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.02
55 0.02
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.05
63 0.05
64 0.06
65 0.08
66 0.1
67 0.18
68 0.27
69 0.34
70 0.44
71 0.54
72 0.61
73 0.71
74 0.8
75 0.83
76 0.85
77 0.8
78 0.74
79 0.69
80 0.64
81 0.56
82 0.49
83 0.43
84 0.35
85 0.34
86 0.3
87 0.25
88 0.22
89 0.2