Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AGA7

Protein Details
Accession A0A437AGA7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-44AVTTTNELSRRKRKRAKKEAAQLEEGRHydrophilic
59-83ESAPAKGSNKPKKSNTKTGGKQDVKHydrophilic
NLS Segment(s)
PositionSequence
27-103RRKRKRAKKEAAQLEEGRPEAPAKKLRTSPDAESAPAKGSNKPKKSNTKTGGKQDVKGKGKGKGKGKGNGNGNGKPM
Subcellular Location(s) cyto 15, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MDDDYDSGEDIIATSNGAVTTTNELSRRKRKRAKKEAAQLEEGRPEAPAKKLRTSPDAESAPAKGSNKPKKSNTKTGGKQDVKGKGKGKGKGKGNGNGNGKPMAKDGGKEDASSIDGSIAMMDPKIMADFVAQRVQKFNKDLSTVELGDHIPSESIYIDTTSHTAERSLQNLCEYMEKFCTKKGQSSISHLKSSPKAVGSPHTIFVTPAALRAADVVRILRKYQTTDSQIAKFFAKHVKLSEHIEYAKKTRIGIAVGTPARLVDLIKDGAVQIKYLQRVVLDVSYLDAKKRGLWDIKEVQDKLVELLAVEGVRRRLEGGGEEDSRGLMFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.07
5 0.08
6 0.08
7 0.14
8 0.16
9 0.2
10 0.23
11 0.29
12 0.38
13 0.49
14 0.57
15 0.62
16 0.71
17 0.78
18 0.85
19 0.9
20 0.92
21 0.92
22 0.93
23 0.92
24 0.88
25 0.85
26 0.78
27 0.7
28 0.63
29 0.53
30 0.42
31 0.32
32 0.28
33 0.23
34 0.26
35 0.3
36 0.31
37 0.37
38 0.43
39 0.47
40 0.51
41 0.53
42 0.51
43 0.52
44 0.49
45 0.44
46 0.4
47 0.36
48 0.32
49 0.31
50 0.28
51 0.26
52 0.35
53 0.43
54 0.5
55 0.57
56 0.64
57 0.71
58 0.78
59 0.83
60 0.8
61 0.81
62 0.8
63 0.82
64 0.83
65 0.75
66 0.72
67 0.69
68 0.7
69 0.65
70 0.63
71 0.58
72 0.55
73 0.58
74 0.6
75 0.61
76 0.59
77 0.61
78 0.63
79 0.65
80 0.65
81 0.64
82 0.65
83 0.62
84 0.57
85 0.51
86 0.48
87 0.42
88 0.35
89 0.3
90 0.26
91 0.21
92 0.19
93 0.2
94 0.23
95 0.23
96 0.22
97 0.21
98 0.18
99 0.18
100 0.17
101 0.15
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.04
116 0.06
117 0.09
118 0.14
119 0.15
120 0.15
121 0.2
122 0.22
123 0.24
124 0.25
125 0.25
126 0.22
127 0.24
128 0.24
129 0.23
130 0.24
131 0.21
132 0.19
133 0.18
134 0.15
135 0.13
136 0.13
137 0.1
138 0.06
139 0.05
140 0.06
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.1
153 0.11
154 0.12
155 0.13
156 0.12
157 0.13
158 0.13
159 0.13
160 0.14
161 0.13
162 0.12
163 0.15
164 0.17
165 0.16
166 0.18
167 0.24
168 0.22
169 0.26
170 0.29
171 0.32
172 0.33
173 0.41
174 0.49
175 0.46
176 0.47
177 0.43
178 0.43
179 0.38
180 0.38
181 0.32
182 0.23
183 0.21
184 0.2
185 0.23
186 0.26
187 0.25
188 0.24
189 0.23
190 0.22
191 0.2
192 0.19
193 0.18
194 0.12
195 0.11
196 0.1
197 0.09
198 0.08
199 0.1
200 0.1
201 0.07
202 0.08
203 0.09
204 0.11
205 0.12
206 0.13
207 0.15
208 0.16
209 0.19
210 0.23
211 0.28
212 0.31
213 0.35
214 0.38
215 0.39
216 0.39
217 0.37
218 0.34
219 0.27
220 0.25
221 0.27
222 0.26
223 0.25
224 0.26
225 0.28
226 0.3
227 0.34
228 0.34
229 0.31
230 0.31
231 0.32
232 0.32
233 0.32
234 0.35
235 0.31
236 0.29
237 0.28
238 0.28
239 0.26
240 0.25
241 0.23
242 0.25
243 0.24
244 0.24
245 0.21
246 0.18
247 0.17
248 0.16
249 0.14
250 0.07
251 0.1
252 0.1
253 0.1
254 0.11
255 0.11
256 0.15
257 0.15
258 0.14
259 0.14
260 0.18
261 0.2
262 0.21
263 0.21
264 0.16
265 0.17
266 0.19
267 0.17
268 0.13
269 0.11
270 0.12
271 0.16
272 0.17
273 0.17
274 0.17
275 0.17
276 0.19
277 0.23
278 0.29
279 0.31
280 0.33
281 0.41
282 0.47
283 0.54
284 0.59
285 0.56
286 0.5
287 0.45
288 0.43
289 0.35
290 0.28
291 0.21
292 0.12
293 0.13
294 0.13
295 0.1
296 0.11
297 0.13
298 0.14
299 0.14
300 0.15
301 0.16
302 0.15
303 0.17
304 0.2
305 0.22
306 0.26
307 0.27
308 0.27
309 0.26
310 0.25