Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A4C9

Protein Details
Accession A0A437A4C9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-99EGKAGAGKKKRRRGKKGGAAGABasic
NLS Segment(s)
PositionSequence
80-98KAGAGKKKRRRGKKGGAAG
146-154AKGLQKKIR
Subcellular Location(s) nucl 12.5, mito_nucl 12.166, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSNPKDSKTTTSGIQTLESGTRVIPSSTRADGSTRPERRVKPGFTPAEDVVKYQNRTAEAWRNRGSGGVPGATDVVGEGKAGAGKKKRRRGKKGGAAGAGGAEGKDEEGEEEGEEGAAEEAAAEPVEKEERVADTAAVSADVEKKAKGLQKKIRQAQELKSRKERGETLLPEQLDKALRLGELIRDLEKLGVKYEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.25
4 0.24
5 0.21
6 0.16
7 0.13
8 0.13
9 0.13
10 0.13
11 0.12
12 0.14
13 0.18
14 0.19
15 0.21
16 0.2
17 0.22
18 0.25
19 0.32
20 0.39
21 0.39
22 0.43
23 0.49
24 0.51
25 0.57
26 0.61
27 0.58
28 0.55
29 0.6
30 0.6
31 0.55
32 0.57
33 0.49
34 0.47
35 0.43
36 0.36
37 0.33
38 0.34
39 0.33
40 0.29
41 0.3
42 0.26
43 0.27
44 0.32
45 0.35
46 0.35
47 0.41
48 0.42
49 0.4
50 0.38
51 0.38
52 0.33
53 0.26
54 0.22
55 0.15
56 0.12
57 0.11
58 0.11
59 0.1
60 0.09
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.03
67 0.05
68 0.06
69 0.1
70 0.16
71 0.25
72 0.34
73 0.44
74 0.53
75 0.62
76 0.71
77 0.78
78 0.82
79 0.83
80 0.82
81 0.78
82 0.7
83 0.6
84 0.5
85 0.39
86 0.28
87 0.19
88 0.1
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.02
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.06
114 0.05
115 0.06
116 0.07
117 0.08
118 0.09
119 0.1
120 0.09
121 0.08
122 0.09
123 0.08
124 0.07
125 0.06
126 0.06
127 0.08
128 0.1
129 0.1
130 0.1
131 0.1
132 0.14
133 0.2
134 0.26
135 0.34
136 0.43
137 0.52
138 0.63
139 0.7
140 0.74
141 0.76
142 0.74
143 0.73
144 0.74
145 0.73
146 0.7
147 0.71
148 0.69
149 0.64
150 0.64
151 0.58
152 0.54
153 0.55
154 0.52
155 0.49
156 0.49
157 0.47
158 0.42
159 0.39
160 0.36
161 0.28
162 0.24
163 0.19
164 0.14
165 0.14
166 0.14
167 0.15
168 0.15
169 0.17
170 0.18
171 0.18
172 0.18
173 0.18
174 0.21
175 0.23
176 0.21