Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A436ZTW7

Protein Details
Accession A0A436ZTW7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-89ESTPTQVRKKKRTEEKIEKVALSHHQDSPKIKTKRRERGKGLFRTNRTNHHydrophilic
NLS Segment(s)
PositionSequence
47-59RKKKRTEEKIEKV
64-80HQDSPKIKTKRRERGKG
Subcellular Location(s) nucl 20, mito_nucl 12.333, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MRNWHDNDGVIKGPFLDSQQRDYFHGRTPGWPANTPCWNESTPTQVRKKKRTEEKIEKVALSHHQDSPKIKTKRRERGKGLFRTNRTNHPFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.22
4 0.21
5 0.27
6 0.31
7 0.32
8 0.34
9 0.38
10 0.37
11 0.34
12 0.39
13 0.34
14 0.32
15 0.37
16 0.39
17 0.37
18 0.39
19 0.37
20 0.36
21 0.4
22 0.4
23 0.34
24 0.32
25 0.29
26 0.26
27 0.25
28 0.26
29 0.26
30 0.31
31 0.39
32 0.42
33 0.49
34 0.56
35 0.63
36 0.65
37 0.71
38 0.74
39 0.76
40 0.81
41 0.82
42 0.81
43 0.75
44 0.66
45 0.55
46 0.48
47 0.43
48 0.38
49 0.33
50 0.29
51 0.3
52 0.33
53 0.36
54 0.41
55 0.45
56 0.47
57 0.51
58 0.57
59 0.65
60 0.73
61 0.8
62 0.83
63 0.81
64 0.85
65 0.88
66 0.88
67 0.89
68 0.87
69 0.82
70 0.82
71 0.78
72 0.77