Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZV88

Protein Details
Accession A0A436ZV88    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
123-152AISTSVLRLQRRRRWRMKRQRQIAMKPVTTHydrophilic
NLS Segment(s)
PositionSequence
133-144RRRRWRMKRQRQ
Subcellular Location(s) mito 11, cyto 9, nucl 5
Family & Domain DBs
Amino Acid Sequences MGALRVVDAAKGLHEHRSCNKTVTLEAGHMIVRCDYWKTFGYSETLHGNITIPCCIYAGAGTLGKSESLARLLSSIPSIVAIRFSSGYLAVNGCGNAAAEYGGGGSLYLRIRDTRLRCLETFAISTSVLRLQRRRRWRMKRQRQIAMKPVTTRAPTKKIHQDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.34
4 0.39
5 0.4
6 0.4
7 0.42
8 0.36
9 0.36
10 0.35
11 0.29
12 0.25
13 0.24
14 0.21
15 0.19
16 0.17
17 0.17
18 0.12
19 0.11
20 0.11
21 0.13
22 0.12
23 0.15
24 0.16
25 0.19
26 0.2
27 0.2
28 0.22
29 0.2
30 0.22
31 0.21
32 0.2
33 0.16
34 0.15
35 0.16
36 0.14
37 0.14
38 0.12
39 0.1
40 0.09
41 0.09
42 0.09
43 0.08
44 0.06
45 0.07
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.06
55 0.07
56 0.07
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.06
65 0.06
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.12
99 0.19
100 0.23
101 0.29
102 0.34
103 0.38
104 0.38
105 0.42
106 0.41
107 0.36
108 0.34
109 0.26
110 0.22
111 0.18
112 0.18
113 0.14
114 0.17
115 0.19
116 0.23
117 0.29
118 0.37
119 0.47
120 0.58
121 0.67
122 0.73
123 0.8
124 0.87
125 0.91
126 0.92
127 0.94
128 0.93
129 0.93
130 0.92
131 0.9
132 0.88
133 0.85
134 0.79
135 0.71
136 0.66
137 0.62
138 0.56
139 0.55
140 0.53
141 0.52
142 0.52
143 0.57