Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437A6L3

Protein Details
Accession A0A437A6L3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-29SLNEAFKLKSNHRKIPRKRKYLLQLVLHydrophilic
NLS Segment(s)
PositionSequence
13-22NHRKIPRKRK
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 8.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MISLNEAFKLKSNHRKIPRKRKYLLQLVLLKSLLQPCIVKKMVGTNLQGLRFGPCVVGCKYTNMSLCIPRHLLERKVQLHDSKAGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.75
3 0.82
4 0.87
5 0.89
6 0.88
7 0.84
8 0.84
9 0.83
10 0.82
11 0.76
12 0.73
13 0.69
14 0.61
15 0.59
16 0.49
17 0.39
18 0.3
19 0.27
20 0.19
21 0.13
22 0.12
23 0.11
24 0.17
25 0.18
26 0.16
27 0.15
28 0.19
29 0.22
30 0.25
31 0.25
32 0.24
33 0.26
34 0.27
35 0.27
36 0.22
37 0.19
38 0.16
39 0.16
40 0.11
41 0.08
42 0.12
43 0.13
44 0.17
45 0.15
46 0.18
47 0.2
48 0.23
49 0.25
50 0.24
51 0.26
52 0.29
53 0.3
54 0.3
55 0.3
56 0.27
57 0.32
58 0.35
59 0.36
60 0.37
61 0.45
62 0.47
63 0.51
64 0.55
65 0.52
66 0.51