Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A436ZZT9

Protein Details
Accession A0A436ZZT9    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-56TSDVSRALRRKQQRERKKRPRSHSSVDPGHydrophilic
NLS Segment(s)
PositionSequence
35-49LRRKQQRERKKRPRS
71-84KKDPRRSTISKEER
86-101IRQRILQMRENKRKGK
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MASATQTKQIASAALASFLQARTAEVPTSDVSRALRRKQQRERKKRPRSHSSVDPGEEGSSESKLSKTTSKKDPRRSTISKEERDIRQRILQMRENKRKGKPIIQPKNSAADSDESDDDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.13
6 0.14
7 0.09
8 0.1
9 0.11
10 0.13
11 0.13
12 0.12
13 0.14
14 0.13
15 0.15
16 0.15
17 0.14
18 0.15
19 0.22
20 0.28
21 0.31
22 0.39
23 0.45
24 0.55
25 0.65
26 0.74
27 0.77
28 0.83
29 0.89
30 0.92
31 0.94
32 0.93
33 0.92
34 0.92
35 0.88
36 0.84
37 0.82
38 0.78
39 0.71
40 0.62
41 0.53
42 0.43
43 0.35
44 0.27
45 0.19
46 0.12
47 0.08
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.15
54 0.2
55 0.25
56 0.35
57 0.46
58 0.54
59 0.64
60 0.72
61 0.72
62 0.76
63 0.76
64 0.73
65 0.74
66 0.74
67 0.68
68 0.64
69 0.64
70 0.62
71 0.64
72 0.59
73 0.52
74 0.48
75 0.48
76 0.49
77 0.49
78 0.5
79 0.53
80 0.61
81 0.67
82 0.7
83 0.73
84 0.73
85 0.75
86 0.74
87 0.73
88 0.73
89 0.73
90 0.76
91 0.76
92 0.77
93 0.71
94 0.73
95 0.64
96 0.55
97 0.46
98 0.38
99 0.34
100 0.31