Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A436ZSP0

Protein Details
Accession A0A436ZSP0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-63HTESPTVKKRKTKAKPKQQAKTTENHydrophilic
NLS Segment(s)
PositionSequence
46-59KKRKTKAKPKQQAK
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MEAAIMSLKRELSPSPAPFNENQTTDENKLFKGEPSTEHTESPTVKKRKTKAKPKQQAKTTENGDGRGKKGTWTEEQDTALHALVTKDQGGNEVKAAWNDIYEGFSKLFPENSKTLNSLQMRWKTKIRAGDTDLAIAEKFLFKQAVANIDGSERVLAYAWRFKELGGRDLNKSAASKLHKMLKSNQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.37
4 0.4
5 0.41
6 0.47
7 0.45
8 0.39
9 0.38
10 0.35
11 0.38
12 0.38
13 0.41
14 0.34
15 0.29
16 0.31
17 0.28
18 0.26
19 0.26
20 0.25
21 0.23
22 0.29
23 0.37
24 0.35
25 0.35
26 0.34
27 0.33
28 0.33
29 0.37
30 0.4
31 0.39
32 0.43
33 0.5
34 0.56
35 0.63
36 0.71
37 0.76
38 0.77
39 0.81
40 0.87
41 0.9
42 0.92
43 0.88
44 0.88
45 0.8
46 0.77
47 0.69
48 0.66
49 0.57
50 0.5
51 0.48
52 0.4
53 0.38
54 0.33
55 0.3
56 0.24
57 0.26
58 0.26
59 0.26
60 0.29
61 0.31
62 0.3
63 0.31
64 0.29
65 0.27
66 0.24
67 0.19
68 0.12
69 0.1
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.1
77 0.1
78 0.11
79 0.1
80 0.1
81 0.1
82 0.09
83 0.11
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.08
90 0.09
91 0.08
92 0.09
93 0.1
94 0.1
95 0.12
96 0.11
97 0.14
98 0.15
99 0.17
100 0.18
101 0.19
102 0.2
103 0.25
104 0.26
105 0.26
106 0.32
107 0.38
108 0.41
109 0.43
110 0.47
111 0.43
112 0.46
113 0.49
114 0.46
115 0.44
116 0.44
117 0.46
118 0.42
119 0.39
120 0.35
121 0.28
122 0.23
123 0.17
124 0.13
125 0.08
126 0.07
127 0.08
128 0.08
129 0.08
130 0.11
131 0.13
132 0.17
133 0.17
134 0.18
135 0.16
136 0.16
137 0.17
138 0.14
139 0.12
140 0.08
141 0.07
142 0.07
143 0.08
144 0.1
145 0.17
146 0.17
147 0.2
148 0.2
149 0.2
150 0.27
151 0.29
152 0.32
153 0.34
154 0.37
155 0.37
156 0.4
157 0.41
158 0.36
159 0.35
160 0.29
161 0.28
162 0.31
163 0.33
164 0.37
165 0.45
166 0.46
167 0.49