Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZXI3

Protein Details
Accession A0A436ZXI3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-124LARLRSKTGKNILKRRKAKGRKMLTHBasic
NLS Segment(s)
PositionSequence
87-121PSHIVRKRRFGFLARLRSKTGKNILKRRKAKGRKM
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MTVLTLLRRPAVSCLRSSSSLLSSTSRRTFTSLLRTPTALATLQTRPTPSTPTPLLPQTISPLLPSASTSLQGLVQTRGHRRKTYNPSHIVRKRRFGFLARLRSKTGKNILKRRKAKGRKMLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.38
4 0.39
5 0.35
6 0.29
7 0.28
8 0.28
9 0.25
10 0.24
11 0.28
12 0.31
13 0.3
14 0.28
15 0.3
16 0.31
17 0.32
18 0.4
19 0.39
20 0.39
21 0.38
22 0.38
23 0.35
24 0.33
25 0.3
26 0.2
27 0.15
28 0.14
29 0.15
30 0.17
31 0.17
32 0.18
33 0.18
34 0.18
35 0.23
36 0.2
37 0.23
38 0.22
39 0.24
40 0.25
41 0.25
42 0.25
43 0.2
44 0.19
45 0.16
46 0.16
47 0.14
48 0.11
49 0.1
50 0.09
51 0.09
52 0.09
53 0.08
54 0.07
55 0.08
56 0.08
57 0.07
58 0.08
59 0.09
60 0.1
61 0.1
62 0.13
63 0.16
64 0.25
65 0.32
66 0.36
67 0.4
68 0.43
69 0.51
70 0.59
71 0.65
72 0.66
73 0.66
74 0.68
75 0.74
76 0.77
77 0.77
78 0.73
79 0.72
80 0.66
81 0.64
82 0.62
83 0.56
84 0.59
85 0.58
86 0.63
87 0.59
88 0.59
89 0.58
90 0.6
91 0.58
92 0.56
93 0.56
94 0.54
95 0.58
96 0.66
97 0.72
98 0.78
99 0.83
100 0.85
101 0.87
102 0.89
103 0.89
104 0.89