Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437A7Z0

Protein Details
Accession A0A437A7Z0   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-36VQETYRRRTAQHQKKKNDKAKVKEWLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, cyto 2.5, mito 2
Family & Domain DBs
Amino Acid Sequences MTFPNPFSAVQETYRRRTAQHQKKKNDKAKVKEWLEFTAQHKHEQWVDEELEPYLLTGTLHLVDTDASDEDHAKERQKGSESPPESPRLSTDIYTHNHATYHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.43
4 0.5
5 0.57
6 0.58
7 0.64
8 0.68
9 0.73
10 0.83
11 0.92
12 0.9
13 0.89
14 0.87
15 0.84
16 0.83
17 0.83
18 0.76
19 0.69
20 0.63
21 0.55
22 0.49
23 0.44
24 0.39
25 0.38
26 0.35
27 0.33
28 0.32
29 0.31
30 0.3
31 0.28
32 0.26
33 0.2
34 0.2
35 0.18
36 0.17
37 0.14
38 0.12
39 0.11
40 0.09
41 0.06
42 0.04
43 0.04
44 0.03
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.05
55 0.06
56 0.07
57 0.08
58 0.13
59 0.15
60 0.17
61 0.21
62 0.23
63 0.27
64 0.31
65 0.33
66 0.35
67 0.43
68 0.43
69 0.45
70 0.47
71 0.48
72 0.45
73 0.42
74 0.38
75 0.31
76 0.31
77 0.27
78 0.26
79 0.28
80 0.3
81 0.34
82 0.34
83 0.31