Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZY21

Protein Details
Accession A0A436ZY21    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFHHIRSKIKRKSIRTLAESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010541  Prp3_C  
IPR017359  UCP038021_RWD  
Pfam View protein in Pfam  
PF06544  DUF1115  
Amino Acid Sequences MFHHIRSKIKRKSIRTLAESMDIRGVCKPGYPGFLYVEGEDSSIRAYVKEIKRMKWQSVEIRRNVQESIPDDVWKNKTNKLETGRLGGPYTVIEVDSSEEMSKILRAAGLEEFLRKAMTGSHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.73
4 0.65
5 0.63
6 0.56
7 0.47
8 0.41
9 0.32
10 0.28
11 0.24
12 0.23
13 0.15
14 0.16
15 0.17
16 0.15
17 0.19
18 0.19
19 0.19
20 0.2
21 0.22
22 0.22
23 0.19
24 0.19
25 0.15
26 0.14
27 0.12
28 0.09
29 0.08
30 0.08
31 0.08
32 0.06
33 0.07
34 0.15
35 0.18
36 0.28
37 0.3
38 0.33
39 0.43
40 0.46
41 0.48
42 0.44
43 0.46
44 0.47
45 0.54
46 0.57
47 0.5
48 0.52
49 0.49
50 0.46
51 0.41
52 0.32
53 0.26
54 0.22
55 0.25
56 0.2
57 0.2
58 0.19
59 0.22
60 0.26
61 0.27
62 0.27
63 0.27
64 0.32
65 0.34
66 0.4
67 0.42
68 0.45
69 0.4
70 0.43
71 0.4
72 0.35
73 0.33
74 0.26
75 0.21
76 0.15
77 0.15
78 0.1
79 0.09
80 0.07
81 0.07
82 0.08
83 0.08
84 0.09
85 0.08
86 0.08
87 0.08
88 0.09
89 0.09
90 0.07
91 0.07
92 0.07
93 0.07
94 0.09
95 0.1
96 0.13
97 0.13
98 0.14
99 0.15
100 0.14
101 0.15
102 0.12
103 0.12