Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437ABG2

Protein Details
Accession A0A437ABG2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LELERLKKQRLQRRKERLEAEAHydrophilic
NLS Segment(s)
PositionSequence
62-80LKKQRLQRRKERLEAEAKK
Subcellular Location(s) cyto 8.5, cyto_nucl 7.5, mito 6, nucl 5.5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGLNLEVFKFGMYILFPIASMYYFGTNLDSRFSVPNFWPSKEETHQIPFERDEIRLELERLKKQRLQRRKERLEAEAKKATLAERG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.07
8 0.07
9 0.08
10 0.08
11 0.08
12 0.08
13 0.1
14 0.11
15 0.11
16 0.12
17 0.11
18 0.12
19 0.14
20 0.14
21 0.14
22 0.14
23 0.23
24 0.23
25 0.24
26 0.24
27 0.24
28 0.28
29 0.28
30 0.29
31 0.23
32 0.25
33 0.27
34 0.27
35 0.26
36 0.22
37 0.23
38 0.21
39 0.19
40 0.17
41 0.15
42 0.17
43 0.16
44 0.17
45 0.2
46 0.25
47 0.31
48 0.33
49 0.37
50 0.4
51 0.47
52 0.57
53 0.61
54 0.66
55 0.7
56 0.77
57 0.81
58 0.85
59 0.81
60 0.79
61 0.79
62 0.76
63 0.73
64 0.69
65 0.6
66 0.52
67 0.48