Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ABM5

Protein Details
Accession A0A437ABM5   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-80KSGERPTGTWKRPRRRPKRSQLKKPPMTKLSIBasic
NLS Segment(s)
PositionSequence
41-73HGPWKGKWKSGERPTGTWKRPRRRPKRSQLKKP
Subcellular Location(s) mito 14, nucl 6, plas 3, cyto 1, extr 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MQLTNILVFLTAALSVAALPYPEEGDKTVSRPPRPTGTGVHGPWKGKWKSGERPTGTWKRPRRRPKRSQLKKPPMTKLSIVPMIFTILTTLNSRFNDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.07
9 0.07
10 0.08
11 0.09
12 0.13
13 0.14
14 0.16
15 0.21
16 0.26
17 0.29
18 0.33
19 0.35
20 0.37
21 0.39
22 0.39
23 0.37
24 0.37
25 0.41
26 0.38
27 0.4
28 0.37
29 0.35
30 0.35
31 0.4
32 0.35
33 0.31
34 0.36
35 0.36
36 0.43
37 0.49
38 0.56
39 0.5
40 0.53
41 0.58
42 0.61
43 0.59
44 0.59
45 0.62
46 0.63
47 0.7
48 0.78
49 0.81
50 0.82
51 0.88
52 0.9
53 0.92
54 0.93
55 0.95
56 0.95
57 0.95
58 0.93
59 0.9
60 0.89
61 0.81
62 0.75
63 0.66
64 0.59
65 0.55
66 0.52
67 0.43
68 0.35
69 0.31
70 0.28
71 0.25
72 0.2
73 0.15
74 0.1
75 0.12
76 0.13
77 0.15
78 0.19