Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZR58

Protein Details
Accession A0A436ZR58    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
103-122CYDPPQRTPVPKPKAKKVGNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, E.R. 4, plas 3, mito 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MQLFITLAMALNFAGAALAAPQVTRVSVPATAPCVTQFTVTTSYPPSNEPYTTTIYTIMEGIPRDLICQGCSLEVVTETINESRTPDATVTATTATLIYKPMCYDPPQRTPVPKPKAKKVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.06
12 0.07
13 0.08
14 0.09
15 0.11
16 0.12
17 0.15
18 0.15
19 0.15
20 0.15
21 0.16
22 0.15
23 0.15
24 0.14
25 0.13
26 0.17
27 0.16
28 0.17
29 0.18
30 0.18
31 0.18
32 0.19
33 0.19
34 0.18
35 0.18
36 0.19
37 0.19
38 0.22
39 0.22
40 0.21
41 0.19
42 0.16
43 0.16
44 0.14
45 0.11
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.07
55 0.08
56 0.08
57 0.07
58 0.08
59 0.07
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.07
66 0.07
67 0.08
68 0.08
69 0.09
70 0.1
71 0.1
72 0.11
73 0.1
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.09
82 0.08
83 0.08
84 0.09
85 0.09
86 0.1
87 0.11
88 0.14
89 0.17
90 0.21
91 0.29
92 0.35
93 0.42
94 0.47
95 0.5
96 0.55
97 0.62
98 0.67
99 0.69
100 0.7
101 0.7
102 0.75