Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437A7R9

Protein Details
Accession A0A437A7R9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-22VTAFGKKLKSKEKAKILKARTHydrophilic
NLS Segment(s)
PositionSequence
7-18KKLKSKEKAKIL
54-59KRARKR
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MVTAFGKKLKSKEKAKILKARTPIEDAITNSADADPDAAVKALNQLYLGQKVPKRARKRELKLSVNLEPNQEELDRVKKRVRTVCNPPRLVLGWLVELDTNLGVLVAGNPPTALADF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.83
4 0.8
5 0.78
6 0.76
7 0.71
8 0.64
9 0.59
10 0.51
11 0.44
12 0.41
13 0.35
14 0.31
15 0.27
16 0.24
17 0.19
18 0.18
19 0.14
20 0.11
21 0.1
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.08
29 0.08
30 0.08
31 0.08
32 0.09
33 0.11
34 0.13
35 0.14
36 0.15
37 0.16
38 0.25
39 0.32
40 0.39
41 0.46
42 0.52
43 0.61
44 0.67
45 0.72
46 0.75
47 0.76
48 0.73
49 0.7
50 0.67
51 0.63
52 0.58
53 0.52
54 0.43
55 0.34
56 0.29
57 0.25
58 0.2
59 0.15
60 0.12
61 0.2
62 0.21
63 0.23
64 0.28
65 0.3
66 0.37
67 0.45
68 0.51
69 0.5
70 0.59
71 0.66
72 0.71
73 0.69
74 0.63
75 0.58
76 0.52
77 0.45
78 0.36
79 0.28
80 0.19
81 0.18
82 0.18
83 0.14
84 0.12
85 0.11
86 0.08
87 0.07
88 0.05
89 0.05
90 0.04
91 0.04
92 0.05
93 0.07
94 0.07
95 0.08
96 0.08
97 0.08