Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A373

Protein Details
Accession A0A437A373    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
40-62TTTTRTTRSSRPHRRHHHTHATTHydrophilic
NLS Segment(s)
PositionSequence
88-101KGSLTRRPGLKAAG
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPYRRVHHTRPAGGHTTVRTTRTKPSLMDRLTGRRSHTTTTTTRTTRSSRPHRRHHHTHATTAVAPVHHQKRRPGLGDKISGALMRLKGSLTRRPGLKAAGARRQRVIHECFDRDMEKATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.46
3 0.45
4 0.41
5 0.39
6 0.37
7 0.35
8 0.41
9 0.43
10 0.44
11 0.39
12 0.44
13 0.49
14 0.46
15 0.48
16 0.45
17 0.47
18 0.49
19 0.48
20 0.44
21 0.41
22 0.42
23 0.4
24 0.39
25 0.36
26 0.35
27 0.37
28 0.4
29 0.35
30 0.35
31 0.36
32 0.37
33 0.39
34 0.46
35 0.52
36 0.56
37 0.64
38 0.72
39 0.78
40 0.82
41 0.85
42 0.84
43 0.84
44 0.75
45 0.69
46 0.61
47 0.53
48 0.44
49 0.36
50 0.27
51 0.16
52 0.14
53 0.18
54 0.24
55 0.25
56 0.27
57 0.31
58 0.38
59 0.43
60 0.47
61 0.45
62 0.45
63 0.48
64 0.48
65 0.44
66 0.38
67 0.34
68 0.29
69 0.24
70 0.19
71 0.15
72 0.12
73 0.11
74 0.11
75 0.15
76 0.19
77 0.25
78 0.28
79 0.32
80 0.33
81 0.36
82 0.38
83 0.36
84 0.38
85 0.38
86 0.4
87 0.45
88 0.5
89 0.5
90 0.52
91 0.53
92 0.53
93 0.52
94 0.5
95 0.49
96 0.5
97 0.5
98 0.47
99 0.49
100 0.44
101 0.38