Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437ABN8

Protein Details
Accession A0A437ABN8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
102-133DEEGWGRKKRLQQRKERARKKKEIEDRIKAEEBasic
NLS Segment(s)
PositionSequence
107-124GRKKRLQQRKERARKKKE
Subcellular Location(s) nucl 20.5, cyto_nucl 15, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSDEEEPLTPSLMFRRLQSRISHNLSGTFGNLSGTDYIRLVAIVGGYLLLRPYLQKIGAKYQERDHARTVDENEQDSMAATGQKARVIAGEGYDLDDDESSDEEGWGRKKRLQQRKERARKKKEIEDRIKAEEDEEDKDIQEFLHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.3
4 0.35
5 0.39
6 0.42
7 0.46
8 0.52
9 0.53
10 0.46
11 0.44
12 0.42
13 0.36
14 0.3
15 0.22
16 0.15
17 0.13
18 0.12
19 0.11
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.04
38 0.04
39 0.06
40 0.08
41 0.1
42 0.12
43 0.14
44 0.22
45 0.3
46 0.33
47 0.33
48 0.34
49 0.41
50 0.42
51 0.43
52 0.38
53 0.32
54 0.3
55 0.3
56 0.3
57 0.28
58 0.26
59 0.24
60 0.21
61 0.19
62 0.18
63 0.16
64 0.12
65 0.06
66 0.06
67 0.05
68 0.07
69 0.07
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.1
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.08
82 0.07
83 0.06
84 0.06
85 0.05
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.09
92 0.14
93 0.2
94 0.21
95 0.25
96 0.33
97 0.44
98 0.54
99 0.61
100 0.68
101 0.73
102 0.83
103 0.9
104 0.92
105 0.93
106 0.93
107 0.93
108 0.91
109 0.9
110 0.9
111 0.9
112 0.89
113 0.88
114 0.83
115 0.78
116 0.72
117 0.61
118 0.52
119 0.46
120 0.39
121 0.33
122 0.29
123 0.24
124 0.22
125 0.22
126 0.21