Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AAE1

Protein Details
Accession A0A437AAE1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-26STSAPRLCWQRSPRNKPVPYAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Amino Acid Sequences MSGSGSTSAPRLCWQRSPRNKPVPYAHDICSIDDLDDHLSIDDNSVSSFLYFSSDKYPHHRLIAGSLERLATIYHPRMLFCFIDTTRLGDELATPIIKRYEIDTECAAAVIILENGEKKSTLQIPFMGEKQAMEDFIRNHLGLERISRPGFGPEGVYTHHRSGTTAYCRES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.63
4 0.71
5 0.76
6 0.81
7 0.81
8 0.79
9 0.79
10 0.75
11 0.71
12 0.65
13 0.57
14 0.55
15 0.52
16 0.46
17 0.38
18 0.32
19 0.25
20 0.2
21 0.19
22 0.13
23 0.12
24 0.11
25 0.08
26 0.09
27 0.09
28 0.09
29 0.08
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.05
37 0.08
38 0.08
39 0.09
40 0.15
41 0.17
42 0.19
43 0.25
44 0.31
45 0.3
46 0.31
47 0.32
48 0.26
49 0.28
50 0.34
51 0.28
52 0.23
53 0.21
54 0.19
55 0.17
56 0.17
57 0.13
58 0.07
59 0.1
60 0.11
61 0.14
62 0.14
63 0.14
64 0.15
65 0.18
66 0.16
67 0.13
68 0.15
69 0.12
70 0.15
71 0.15
72 0.16
73 0.13
74 0.13
75 0.13
76 0.09
77 0.09
78 0.07
79 0.08
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.08
87 0.15
88 0.15
89 0.18
90 0.18
91 0.18
92 0.18
93 0.17
94 0.15
95 0.08
96 0.07
97 0.05
98 0.04
99 0.03
100 0.04
101 0.05
102 0.05
103 0.06
104 0.06
105 0.06
106 0.11
107 0.16
108 0.18
109 0.19
110 0.21
111 0.24
112 0.27
113 0.27
114 0.25
115 0.19
116 0.17
117 0.18
118 0.17
119 0.14
120 0.13
121 0.15
122 0.14
123 0.18
124 0.2
125 0.17
126 0.17
127 0.18
128 0.19
129 0.17
130 0.21
131 0.21
132 0.23
133 0.24
134 0.24
135 0.23
136 0.25
137 0.25
138 0.21
139 0.2
140 0.16
141 0.18
142 0.2
143 0.23
144 0.25
145 0.26
146 0.28
147 0.25
148 0.25
149 0.27
150 0.34
151 0.38