Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A436ZYC6

Protein Details
Accession A0A436ZYC6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-28LAVYPPPPRRRMRKTWLQRQILLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 8, cyto 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024512  Ser_palmitoyltrfase_ssu-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF11779  SPT_ssu-like  
Amino Acid Sequences MTTTLAVYPPPPRRRMRKTWLQRQILLFEVTVGPYVMSPGEKLAFYTFLFLFLSLLTAAVALYLPQHLQTITRRLLFYIFGDDCVIRNEDVLGYNSDFIEVVGFKGNNAIAKPLGFSMGHGEVQSYMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.78
4 0.79
5 0.83
6 0.87
7 0.88
8 0.84
9 0.8
10 0.73
11 0.66
12 0.58
13 0.48
14 0.37
15 0.27
16 0.21
17 0.16
18 0.13
19 0.1
20 0.07
21 0.06
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.08
28 0.07
29 0.08
30 0.09
31 0.1
32 0.1
33 0.13
34 0.11
35 0.11
36 0.11
37 0.1
38 0.09
39 0.07
40 0.08
41 0.05
42 0.05
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.02
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.06
56 0.09
57 0.14
58 0.16
59 0.19
60 0.18
61 0.19
62 0.19
63 0.18
64 0.16
65 0.17
66 0.15
67 0.13
68 0.14
69 0.14
70 0.13
71 0.14
72 0.15
73 0.09
74 0.09
75 0.09
76 0.08
77 0.1
78 0.11
79 0.11
80 0.11
81 0.12
82 0.11
83 0.11
84 0.1
85 0.09
86 0.09
87 0.07
88 0.07
89 0.11
90 0.11
91 0.1
92 0.13
93 0.14
94 0.15
95 0.15
96 0.17
97 0.13
98 0.14
99 0.15
100 0.13
101 0.15
102 0.13
103 0.13
104 0.16
105 0.18
106 0.19
107 0.18
108 0.18