Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A436ZP06

Protein Details
Accession A0A436ZP06    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
383-404GGEAEMKRREKKAKVDKSKKAEBasic
NLS Segment(s)
PositionSequence
389-404KRREKKAKVDKSKKAE
Subcellular Location(s) plas 23, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013657  SCL35B1-4/HUT1  
Gene Ontology GO:0016020  C:membrane  
GO:0008643  P:carbohydrate transport  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF08449  UAA  
Amino Acid Sequences MARPKQANPRQLSSEDIALHKLETQELRTPTKSQPSSPISPSNGVADNSKPLVQRPRRRSFVSEEIATHPTVVELVICVAGIYMSFLTWALLQERITTTPYGPNKRRFKFHLVLLTVQSLCASAIGYLYILYTSRQSRVPPIFPTRKIAAYYLLIAISSSLAAPFGYAALSHIDYITFILAKSCKLLPVMFLHLTLYQRRYPLYKYVVVLLVTSGVAVFTLYNNPAGAAKKHKGSDTSSLYGLLLLSINLLLDGVTNSTQDHMFATSGGLVTGPQMQCGLNLVSSLLTAGWLVVNPWSSELTDAIGFMRENPNVVGDVMGFALCGAIGQVFIFYTLSRFGSLTLVTVTVTRKMFSMILSVFAFGHTLSLMQWLGVGLVFGGIGGEAEMKRREKKAKVDKSKKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.43
3 0.38
4 0.33
5 0.28
6 0.27
7 0.23
8 0.21
9 0.21
10 0.21
11 0.24
12 0.29
13 0.33
14 0.39
15 0.39
16 0.42
17 0.44
18 0.52
19 0.5
20 0.46
21 0.51
22 0.53
23 0.56
24 0.57
25 0.58
26 0.52
27 0.51
28 0.49
29 0.43
30 0.39
31 0.34
32 0.31
33 0.26
34 0.26
35 0.25
36 0.27
37 0.24
38 0.26
39 0.36
40 0.44
41 0.53
42 0.59
43 0.67
44 0.7
45 0.74
46 0.74
47 0.71
48 0.71
49 0.67
50 0.59
51 0.52
52 0.49
53 0.47
54 0.41
55 0.33
56 0.23
57 0.16
58 0.14
59 0.11
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.08
78 0.09
79 0.1
80 0.12
81 0.14
82 0.15
83 0.16
84 0.16
85 0.16
86 0.22
87 0.3
88 0.38
89 0.44
90 0.52
91 0.61
92 0.64
93 0.7
94 0.68
95 0.7
96 0.65
97 0.64
98 0.63
99 0.56
100 0.54
101 0.49
102 0.45
103 0.36
104 0.3
105 0.23
106 0.14
107 0.11
108 0.09
109 0.07
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.05
119 0.08
120 0.1
121 0.12
122 0.14
123 0.15
124 0.23
125 0.28
126 0.31
127 0.33
128 0.41
129 0.47
130 0.46
131 0.51
132 0.45
133 0.43
134 0.41
135 0.36
136 0.29
137 0.22
138 0.22
139 0.17
140 0.14
141 0.12
142 0.1
143 0.09
144 0.06
145 0.05
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.05
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.04
165 0.04
166 0.06
167 0.06
168 0.07
169 0.08
170 0.08
171 0.09
172 0.1
173 0.1
174 0.1
175 0.12
176 0.16
177 0.14
178 0.14
179 0.14
180 0.15
181 0.17
182 0.17
183 0.18
184 0.15
185 0.16
186 0.17
187 0.18
188 0.18
189 0.22
190 0.24
191 0.24
192 0.23
193 0.24
194 0.24
195 0.23
196 0.2
197 0.14
198 0.11
199 0.08
200 0.07
201 0.05
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.05
208 0.05
209 0.06
210 0.06
211 0.06
212 0.08
213 0.09
214 0.11
215 0.16
216 0.18
217 0.22
218 0.24
219 0.25
220 0.26
221 0.28
222 0.34
223 0.33
224 0.33
225 0.29
226 0.28
227 0.26
228 0.24
229 0.2
230 0.12
231 0.07
232 0.04
233 0.04
234 0.04
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.04
242 0.05
243 0.05
244 0.05
245 0.06
246 0.07
247 0.07
248 0.07
249 0.07
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.06
256 0.06
257 0.05
258 0.05
259 0.11
260 0.1
261 0.1
262 0.11
263 0.11
264 0.11
265 0.13
266 0.13
267 0.08
268 0.08
269 0.08
270 0.07
271 0.07
272 0.07
273 0.05
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.06
281 0.07
282 0.07
283 0.08
284 0.09
285 0.09
286 0.1
287 0.1
288 0.1
289 0.09
290 0.09
291 0.08
292 0.09
293 0.09
294 0.1
295 0.14
296 0.13
297 0.14
298 0.14
299 0.15
300 0.14
301 0.14
302 0.12
303 0.08
304 0.08
305 0.07
306 0.07
307 0.05
308 0.04
309 0.04
310 0.04
311 0.03
312 0.03
313 0.03
314 0.03
315 0.03
316 0.04
317 0.04
318 0.04
319 0.05
320 0.05
321 0.06
322 0.08
323 0.09
324 0.1
325 0.1
326 0.11
327 0.12
328 0.12
329 0.12
330 0.11
331 0.11
332 0.1
333 0.12
334 0.13
335 0.16
336 0.17
337 0.16
338 0.16
339 0.18
340 0.19
341 0.17
342 0.21
343 0.16
344 0.19
345 0.19
346 0.2
347 0.18
348 0.17
349 0.17
350 0.1
351 0.1
352 0.06
353 0.06
354 0.06
355 0.09
356 0.09
357 0.08
358 0.08
359 0.08
360 0.08
361 0.08
362 0.07
363 0.04
364 0.04
365 0.04
366 0.03
367 0.03
368 0.03
369 0.03
370 0.03
371 0.06
372 0.07
373 0.11
374 0.17
375 0.22
376 0.28
377 0.36
378 0.45
379 0.5
380 0.61
381 0.68
382 0.74
383 0.81
384 0.86