Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZVR5

Protein Details
Accession A0A436ZVR5    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-37LSTNRDQGSGRNRNNRRRRRIPPGERLNKPLKRHydrophilic
NLS Segment(s)
PositionSequence
15-37RNRNNRRRRRIPPGERLNKPLKR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032752  DC-UbP/UBTD2_N  
IPR038169  DC-UbP/UBTD2_N_sf  
IPR039869  UBTD1/2  
Pfam View protein in Pfam  
PF16455  UBD  
Amino Acid Sequences MGGCLSTNRDQGSGRNRNNRRRRRIPPGERLNKPLKRPIWTHDVEADGPPPSITSLQRERDDFWFTRVTGRPEIWSVIKRVCEMLMTDDSDQQLANAREMLRVAEITLPTGAFDGGAWDKYGNSYRVPRRIVSNPTNVGAASPPRNSIDSWESSESGKSNMSGGRAASELSAVSYIVKFRVQYGNASIDAQIQVWSDEKLKKAAKRLLTELEIAPEDHRAYVVMDGRPFDLKKKLMDPGQPPWLANRIIQAFVRPIIDPESSPSPPGPMDKPLLVPFPAPPNTQYAQPEVGTSQRSEENQGPGPSRRARSSDSKASAESQTPTLISNSISV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.67
4 0.76
5 0.86
6 0.89
7 0.89
8 0.89
9 0.9
10 0.9
11 0.92
12 0.92
13 0.92
14 0.92
15 0.92
16 0.86
17 0.84
18 0.83
19 0.78
20 0.73
21 0.72
22 0.66
23 0.63
24 0.62
25 0.6
26 0.59
27 0.55
28 0.53
29 0.47
30 0.44
31 0.39
32 0.36
33 0.32
34 0.24
35 0.21
36 0.18
37 0.14
38 0.12
39 0.14
40 0.14
41 0.2
42 0.27
43 0.33
44 0.37
45 0.39
46 0.41
47 0.41
48 0.47
49 0.4
50 0.36
51 0.33
52 0.3
53 0.35
54 0.37
55 0.38
56 0.35
57 0.35
58 0.34
59 0.32
60 0.34
61 0.31
62 0.29
63 0.27
64 0.27
65 0.28
66 0.26
67 0.25
68 0.22
69 0.19
70 0.17
71 0.18
72 0.17
73 0.18
74 0.18
75 0.19
76 0.19
77 0.18
78 0.17
79 0.12
80 0.16
81 0.15
82 0.14
83 0.15
84 0.15
85 0.16
86 0.16
87 0.17
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.1
94 0.1
95 0.09
96 0.08
97 0.09
98 0.08
99 0.05
100 0.05
101 0.06
102 0.07
103 0.07
104 0.08
105 0.07
106 0.08
107 0.1
108 0.14
109 0.12
110 0.14
111 0.22
112 0.28
113 0.35
114 0.37
115 0.36
116 0.38
117 0.43
118 0.48
119 0.46
120 0.47
121 0.42
122 0.4
123 0.39
124 0.33
125 0.28
126 0.21
127 0.18
128 0.15
129 0.13
130 0.14
131 0.15
132 0.16
133 0.16
134 0.18
135 0.19
136 0.18
137 0.2
138 0.21
139 0.2
140 0.2
141 0.21
142 0.17
143 0.14
144 0.12
145 0.09
146 0.09
147 0.09
148 0.1
149 0.1
150 0.09
151 0.09
152 0.09
153 0.09
154 0.07
155 0.07
156 0.05
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.06
165 0.06
166 0.09
167 0.13
168 0.14
169 0.15
170 0.17
171 0.19
172 0.19
173 0.19
174 0.17
175 0.13
176 0.13
177 0.12
178 0.1
179 0.07
180 0.07
181 0.08
182 0.08
183 0.11
184 0.13
185 0.14
186 0.19
187 0.24
188 0.26
189 0.34
190 0.39
191 0.41
192 0.42
193 0.45
194 0.43
195 0.4
196 0.39
197 0.32
198 0.28
199 0.22
200 0.19
201 0.15
202 0.13
203 0.12
204 0.09
205 0.09
206 0.08
207 0.08
208 0.1
209 0.14
210 0.14
211 0.15
212 0.16
213 0.17
214 0.2
215 0.2
216 0.2
217 0.22
218 0.23
219 0.25
220 0.28
221 0.32
222 0.34
223 0.4
224 0.42
225 0.42
226 0.48
227 0.46
228 0.42
229 0.4
230 0.39
231 0.33
232 0.28
233 0.28
234 0.22
235 0.23
236 0.23
237 0.22
238 0.19
239 0.19
240 0.2
241 0.15
242 0.14
243 0.16
244 0.17
245 0.15
246 0.18
247 0.22
248 0.21
249 0.23
250 0.22
251 0.2
252 0.2
253 0.24
254 0.22
255 0.2
256 0.23
257 0.23
258 0.27
259 0.27
260 0.29
261 0.26
262 0.24
263 0.23
264 0.27
265 0.29
266 0.27
267 0.26
268 0.29
269 0.29
270 0.33
271 0.33
272 0.29
273 0.29
274 0.28
275 0.28
276 0.23
277 0.26
278 0.23
279 0.22
280 0.21
281 0.22
282 0.23
283 0.27
284 0.3
285 0.32
286 0.36
287 0.39
288 0.41
289 0.41
290 0.47
291 0.49
292 0.49
293 0.49
294 0.47
295 0.49
296 0.55
297 0.59
298 0.62
299 0.61
300 0.58
301 0.56
302 0.55
303 0.53
304 0.46
305 0.4
306 0.32
307 0.28
308 0.25
309 0.24
310 0.22
311 0.19