Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZQW1

Protein Details
Accession A0A436ZQW1    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-32AKSGPGRKKKPTTPTEPTRRSBasic
83-102KPSAKKTKTADAKSTKKTKTHydrophilic
NLS Segment(s)
PositionSequence
15-24GPGRKKKPTT
47-104TKPKAAPKKRKTTVVKEKIVAAPKKAKATVTKKPGPKPSAKKTKTADAKSTKKTKTKA
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAPTTGANTTAAKSGPGRKKKPTTPTEPTRRSTRAVVPRTIFSSGVTKPKAAPKKRKTTVVKEKIVAAPKKAKATVTKKPGPKPSAKKTKTADAKSTKKTKTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.35
3 0.44
4 0.49
5 0.57
6 0.66
7 0.72
8 0.78
9 0.77
10 0.77
11 0.76
12 0.8
13 0.82
14 0.79
15 0.75
16 0.72
17 0.66
18 0.6
19 0.55
20 0.53
21 0.52
22 0.5
23 0.52
24 0.46
25 0.45
26 0.44
27 0.41
28 0.32
29 0.24
30 0.23
31 0.2
32 0.24
33 0.23
34 0.21
35 0.21
36 0.29
37 0.37
38 0.41
39 0.5
40 0.52
41 0.63
42 0.66
43 0.74
44 0.73
45 0.75
46 0.78
47 0.77
48 0.72
49 0.62
50 0.61
51 0.56
52 0.57
53 0.48
54 0.41
55 0.4
56 0.39
57 0.42
58 0.4
59 0.38
60 0.4
61 0.46
62 0.51
63 0.52
64 0.56
65 0.59
66 0.66
67 0.73
68 0.7
69 0.72
70 0.73
71 0.75
72 0.79
73 0.74
74 0.75
75 0.7
76 0.74
77 0.74
78 0.71
79 0.7
80 0.69
81 0.76
82 0.77
83 0.81
84 0.79