Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437A2G4

Protein Details
Accession A0A437A2G4   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-87AGPEAQQRRRDKKRAERDAKAIREBasic
NLS Segment(s)
PositionSequence
71-81RRRDKKRAERD
Subcellular Location(s) nucl 7.5, mito 7, cyto_nucl 7, pero 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006694  Fatty_acid_hydroxylase  
Gene Ontology GO:0005506  F:iron ion binding  
GO:0016491  F:oxidoreductase activity  
GO:0044255  P:cellular lipid metabolic process  
GO:0008610  P:lipid biosynthetic process  
Pfam View protein in Pfam  
PF04116  FA_hydroxylase  
Amino Acid Sequences MYLWICLRLFQAIDAHSGYDFPWSLHHFIPFWAGAAHHDVHHEKFIGNYASSFRWWDYVLDTEAGPEAQQRRRDKKRAERDAKAIREQQKLSMESMGRDAAVMGSQIALEKKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.14
5 0.13
6 0.12
7 0.11
8 0.09
9 0.13
10 0.15
11 0.18
12 0.19
13 0.21
14 0.18
15 0.18
16 0.21
17 0.17
18 0.14
19 0.12
20 0.11
21 0.1
22 0.13
23 0.13
24 0.11
25 0.13
26 0.15
27 0.15
28 0.17
29 0.16
30 0.13
31 0.12
32 0.15
33 0.14
34 0.12
35 0.11
36 0.12
37 0.12
38 0.13
39 0.13
40 0.1
41 0.1
42 0.11
43 0.1
44 0.1
45 0.11
46 0.11
47 0.11
48 0.1
49 0.09
50 0.09
51 0.08
52 0.07
53 0.08
54 0.11
55 0.16
56 0.23
57 0.31
58 0.41
59 0.5
60 0.59
61 0.67
62 0.73
63 0.79
64 0.83
65 0.84
66 0.8
67 0.81
68 0.82
69 0.77
70 0.73
71 0.69
72 0.65
73 0.63
74 0.58
75 0.54
76 0.51
77 0.47
78 0.43
79 0.4
80 0.34
81 0.28
82 0.29
83 0.24
84 0.17
85 0.16
86 0.14
87 0.09
88 0.09
89 0.08
90 0.06
91 0.05
92 0.06
93 0.08
94 0.09