Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A1J2

Protein Details
Accession A0A437A1J2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-104GEYTGRTSRGKRHRRRCSFRVIBasic
NLS Segment(s)
PositionSequence
93-96KRHR
Subcellular Location(s) mito 8extr 8, plas 4, cyto 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSPAEKSHHCIASHLWSLYRCLLANPIVSKERARWKKRLAGLPCGYRDKPLRPSRATITTASFVLLTVLGLGLIEGTGVRLGEYTGRTSRGKRHRRRCSFRVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.32
4 0.27
5 0.3
6 0.3
7 0.28
8 0.2
9 0.16
10 0.18
11 0.18
12 0.21
13 0.19
14 0.21
15 0.21
16 0.23
17 0.23
18 0.26
19 0.34
20 0.41
21 0.45
22 0.49
23 0.54
24 0.6
25 0.66
26 0.69
27 0.63
28 0.62
29 0.62
30 0.59
31 0.57
32 0.54
33 0.47
34 0.42
35 0.41
36 0.36
37 0.4
38 0.42
39 0.45
40 0.42
41 0.45
42 0.45
43 0.47
44 0.45
45 0.37
46 0.33
47 0.27
48 0.25
49 0.22
50 0.18
51 0.12
52 0.1
53 0.08
54 0.05
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.07
71 0.09
72 0.13
73 0.15
74 0.19
75 0.22
76 0.26
77 0.35
78 0.44
79 0.53
80 0.6
81 0.69
82 0.76
83 0.85
84 0.92