Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A9V3

Protein Details
Accession A0A437A9V3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-90VMINSAKKKKAKKAAAAAKKTSHydrophilic
NLS Segment(s)
PositionSequence
74-90AKKKKAKKAAAAAKKTS
Subcellular Location(s) plas 21, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLDKIAGLAMLLIASTVFLYYTVWTLLTPFIDEDHPIQSLFPPRVWAIRIPVILLLIISAVVGSFLSVVMINSAKKKKAKKAAAAAKKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.08
14 0.08
15 0.08
16 0.07
17 0.08
18 0.08
19 0.1
20 0.1
21 0.1
22 0.11
23 0.1
24 0.1
25 0.11
26 0.14
27 0.15
28 0.13
29 0.14
30 0.14
31 0.15
32 0.16
33 0.15
34 0.14
35 0.17
36 0.17
37 0.15
38 0.15
39 0.13
40 0.12
41 0.11
42 0.07
43 0.03
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.05
57 0.07
58 0.09
59 0.16
60 0.2
61 0.26
62 0.33
63 0.41
64 0.5
65 0.59
66 0.67
67 0.7
68 0.77
69 0.82
70 0.86