Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ABH1

Protein Details
Accession A0A437ABH1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
6-31LFTKLAPKPLKSKEKNKPQSNPTVVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
Amino Acid Sequences MAAFKLFTKLAPKPLKSKEKNKPQSNPTVVPKRYDQQLQLPPGRSIFDVFPNEIIIAIIEHMPVRDKDSFSRCSTFCYKLSFPLRRSLVLTPESIEKFQDGGVCQHLRGLIQSIRFGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.7
4 0.77
5 0.77
6 0.8
7 0.87
8 0.88
9 0.87
10 0.83
11 0.85
12 0.81
13 0.78
14 0.75
15 0.75
16 0.67
17 0.61
18 0.58
19 0.51
20 0.49
21 0.45
22 0.39
23 0.38
24 0.44
25 0.46
26 0.47
27 0.45
28 0.41
29 0.38
30 0.36
31 0.27
32 0.22
33 0.17
34 0.18
35 0.17
36 0.17
37 0.16
38 0.15
39 0.15
40 0.13
41 0.11
42 0.06
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.09
52 0.1
53 0.12
54 0.16
55 0.21
56 0.25
57 0.27
58 0.31
59 0.28
60 0.31
61 0.35
62 0.34
63 0.31
64 0.33
65 0.31
66 0.36
67 0.45
68 0.46
69 0.43
70 0.48
71 0.48
72 0.43
73 0.46
74 0.4
75 0.36
76 0.31
77 0.3
78 0.23
79 0.27
80 0.27
81 0.24
82 0.22
83 0.18
84 0.16
85 0.17
86 0.18
87 0.14
88 0.15
89 0.21
90 0.21
91 0.2
92 0.22
93 0.21
94 0.19
95 0.19
96 0.22
97 0.19
98 0.2
99 0.24