Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A4V6

Protein Details
Accession A0A437A4V6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-26PKPGWSSRPQKAPKHSGKRAGNHydrophilic
NLS Segment(s)
PositionSequence
14-23QKAPKHSGKR
Subcellular Location(s) mito 18, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MLPLPKPGWSSRPQKAPKHSGKRAGNAIRYMWGSNAGKAGATGTVIPPRPLEQLREQDLNTKAEWDAAQFMKHPAYKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.77
4 0.8
5 0.82
6 0.81
7 0.81
8 0.78
9 0.76
10 0.76
11 0.71
12 0.65
13 0.56
14 0.49
15 0.42
16 0.37
17 0.31
18 0.22
19 0.22
20 0.18
21 0.16
22 0.16
23 0.13
24 0.12
25 0.11
26 0.11
27 0.06
28 0.05
29 0.05
30 0.05
31 0.09
32 0.1
33 0.1
34 0.11
35 0.12
36 0.16
37 0.17
38 0.2
39 0.23
40 0.3
41 0.34
42 0.36
43 0.35
44 0.38
45 0.4
46 0.37
47 0.31
48 0.26
49 0.21
50 0.2
51 0.2
52 0.15
53 0.17
54 0.16
55 0.18
56 0.17
57 0.2
58 0.24
59 0.28