Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZRM4

Protein Details
Accession A0A436ZRM4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
492-519PAAASRKKACTTRRHVRHYRHHNKAGSYHydrophilic
NLS Segment(s)
PositionSequence
487-499APRPRPAAASRKK
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR018535  DUF1996  
Pfam View protein in Pfam  
PF09362  DUF1996  
Amino Acid Sequences MKTSTFVSLLVSAASFSGTANAASKKPSRTFGTLSFGGGKELTRCRLDPIVNPGGVAGHMHSIFGGNGFTDLMPGDYASTQSTCTNANVKNDHSNYWVPSLYFRSPEDGTLYPVELFYAKVYYFFEATNDDIKPFPKGFRMRAGDPSLRHPPNPVRNNLDSSKGPITPAQWTCPRDKPTTPLYPPDSDGTKGVGVQDPSNGGQGWGFPDQECDGYASPLRADVHFPSCVNPEVDVEDWKNNSAYPSSNGQGGEDCPPGWIHVPHVFMEVYWNTLKFKDMWQKGAGKQPWVLSNGDTTGYSVHADFINGWDSATLAYLIDNCDPGHAGLASCPGLPGGETSEEEMKACKLTCPLAEGSSDNYGSPLADNKLFGNNPFSGYQAEPYAVPGSNSPAPVESKPVVNPESVPATTKAAAPATSARPSTTLKPVVKPVDTPKPVNTPKPVNSPGEYIPENHNVHTKVIESIRIHTITKTVVIHGGAPGPKTVAPRPRPAAASRKKACTTRRHVRHYRHHNKAGSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.08
5 0.08
6 0.09
7 0.12
8 0.16
9 0.16
10 0.22
11 0.28
12 0.33
13 0.37
14 0.43
15 0.45
16 0.48
17 0.52
18 0.53
19 0.55
20 0.48
21 0.46
22 0.44
23 0.38
24 0.33
25 0.29
26 0.24
27 0.22
28 0.27
29 0.29
30 0.28
31 0.29
32 0.32
33 0.38
34 0.4
35 0.39
36 0.43
37 0.45
38 0.41
39 0.4
40 0.35
41 0.29
42 0.26
43 0.22
44 0.14
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.1
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.1
66 0.1
67 0.11
68 0.11
69 0.13
70 0.13
71 0.15
72 0.22
73 0.24
74 0.3
75 0.32
76 0.35
77 0.43
78 0.44
79 0.43
80 0.41
81 0.41
82 0.36
83 0.36
84 0.33
85 0.24
86 0.26
87 0.3
88 0.27
89 0.27
90 0.25
91 0.27
92 0.26
93 0.27
94 0.28
95 0.23
96 0.24
97 0.22
98 0.22
99 0.17
100 0.16
101 0.16
102 0.11
103 0.11
104 0.09
105 0.09
106 0.08
107 0.09
108 0.11
109 0.12
110 0.12
111 0.12
112 0.12
113 0.13
114 0.15
115 0.17
116 0.17
117 0.16
118 0.16
119 0.17
120 0.2
121 0.19
122 0.19
123 0.23
124 0.29
125 0.31
126 0.39
127 0.44
128 0.43
129 0.49
130 0.54
131 0.5
132 0.46
133 0.49
134 0.49
135 0.45
136 0.43
137 0.41
138 0.44
139 0.5
140 0.54
141 0.53
142 0.51
143 0.52
144 0.57
145 0.53
146 0.49
147 0.39
148 0.38
149 0.35
150 0.29
151 0.27
152 0.23
153 0.23
154 0.26
155 0.27
156 0.27
157 0.3
158 0.32
159 0.37
160 0.42
161 0.46
162 0.43
163 0.43
164 0.43
165 0.44
166 0.51
167 0.48
168 0.47
169 0.47
170 0.44
171 0.44
172 0.42
173 0.36
174 0.28
175 0.26
176 0.21
177 0.16
178 0.15
179 0.14
180 0.14
181 0.13
182 0.12
183 0.13
184 0.12
185 0.13
186 0.13
187 0.12
188 0.09
189 0.08
190 0.09
191 0.11
192 0.1
193 0.1
194 0.09
195 0.11
196 0.11
197 0.12
198 0.12
199 0.11
200 0.1
201 0.1
202 0.11
203 0.1
204 0.09
205 0.11
206 0.11
207 0.1
208 0.12
209 0.13
210 0.15
211 0.16
212 0.16
213 0.16
214 0.17
215 0.18
216 0.16
217 0.14
218 0.12
219 0.12
220 0.13
221 0.13
222 0.13
223 0.14
224 0.14
225 0.14
226 0.13
227 0.11
228 0.12
229 0.11
230 0.1
231 0.11
232 0.13
233 0.13
234 0.16
235 0.15
236 0.15
237 0.14
238 0.14
239 0.14
240 0.12
241 0.11
242 0.1
243 0.1
244 0.1
245 0.11
246 0.1
247 0.09
248 0.12
249 0.14
250 0.14
251 0.15
252 0.14
253 0.13
254 0.16
255 0.13
256 0.12
257 0.11
258 0.11
259 0.1
260 0.11
261 0.12
262 0.1
263 0.15
264 0.22
265 0.24
266 0.27
267 0.29
268 0.34
269 0.36
270 0.44
271 0.4
272 0.32
273 0.32
274 0.31
275 0.3
276 0.28
277 0.26
278 0.18
279 0.17
280 0.16
281 0.14
282 0.12
283 0.1
284 0.08
285 0.08
286 0.08
287 0.07
288 0.07
289 0.06
290 0.07
291 0.06
292 0.07
293 0.08
294 0.08
295 0.08
296 0.06
297 0.07
298 0.06
299 0.07
300 0.06
301 0.04
302 0.04
303 0.05
304 0.06
305 0.06
306 0.07
307 0.07
308 0.07
309 0.07
310 0.07
311 0.08
312 0.07
313 0.06
314 0.06
315 0.08
316 0.08
317 0.08
318 0.08
319 0.07
320 0.06
321 0.06
322 0.07
323 0.06
324 0.07
325 0.08
326 0.1
327 0.12
328 0.12
329 0.12
330 0.13
331 0.11
332 0.11
333 0.11
334 0.11
335 0.11
336 0.13
337 0.13
338 0.16
339 0.16
340 0.16
341 0.17
342 0.16
343 0.17
344 0.18
345 0.17
346 0.14
347 0.13
348 0.12
349 0.11
350 0.11
351 0.11
352 0.11
353 0.11
354 0.12
355 0.13
356 0.18
357 0.18
358 0.19
359 0.2
360 0.18
361 0.2
362 0.2
363 0.2
364 0.17
365 0.17
366 0.18
367 0.15
368 0.14
369 0.12
370 0.13
371 0.14
372 0.12
373 0.12
374 0.11
375 0.15
376 0.17
377 0.17
378 0.16
379 0.16
380 0.19
381 0.19
382 0.24
383 0.2
384 0.2
385 0.21
386 0.26
387 0.25
388 0.23
389 0.23
390 0.2
391 0.24
392 0.22
393 0.22
394 0.19
395 0.21
396 0.21
397 0.22
398 0.21
399 0.18
400 0.17
401 0.17
402 0.2
403 0.22
404 0.25
405 0.24
406 0.22
407 0.24
408 0.27
409 0.3
410 0.33
411 0.37
412 0.37
413 0.4
414 0.47
415 0.49
416 0.48
417 0.48
418 0.48
419 0.5
420 0.51
421 0.5
422 0.48
423 0.52
424 0.56
425 0.58
426 0.58
427 0.56
428 0.57
429 0.63
430 0.63
431 0.58
432 0.55
433 0.53
434 0.48
435 0.45
436 0.41
437 0.34
438 0.34
439 0.38
440 0.37
441 0.34
442 0.37
443 0.33
444 0.33
445 0.32
446 0.28
447 0.25
448 0.25
449 0.31
450 0.26
451 0.28
452 0.33
453 0.34
454 0.34
455 0.29
456 0.29
457 0.24
458 0.27
459 0.24
460 0.19
461 0.2
462 0.2
463 0.2
464 0.19
465 0.23
466 0.21
467 0.21
468 0.2
469 0.19
470 0.21
471 0.24
472 0.3
473 0.35
474 0.39
475 0.48
476 0.52
477 0.56
478 0.58
479 0.6
480 0.63
481 0.63
482 0.68
483 0.65
484 0.69
485 0.69
486 0.73
487 0.75
488 0.75
489 0.76
490 0.76
491 0.8
492 0.82
493 0.85
494 0.88
495 0.91
496 0.91
497 0.92
498 0.91
499 0.9