Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A436ZSS6

Protein Details
Accession A0A436ZSS6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-43LWKIPWRLSRFQKYRQRQRLRRVDRVVEHydrophilic
79-102TIFDKKHKGYRKGIHKLPKWTRVSBasic
NLS Segment(s)
PositionSequence
84-94KHKGYRKGIHK
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNALMGGLLWKIPWRLSRFQKYRQRQRLRRVDRVVETISNALAQQGMVSKAVETWKAEMPTEAEMLPRDKYTIFDKKHKGYRKGIHKLPKWTRVSQRINPIGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.1
5 0.11
6 0.13
7 0.19
8 0.22
9 0.31
10 0.4
11 0.51
12 0.56
13 0.66
14 0.73
15 0.78
16 0.84
17 0.86
18 0.88
19 0.86
20 0.9
21 0.91
22 0.89
23 0.88
24 0.83
25 0.78
26 0.7
27 0.66
28 0.57
29 0.46
30 0.39
31 0.29
32 0.23
33 0.16
34 0.13
35 0.08
36 0.06
37 0.05
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.08
46 0.09
47 0.08
48 0.1
49 0.13
50 0.14
51 0.14
52 0.13
53 0.14
54 0.14
55 0.14
56 0.12
57 0.1
58 0.1
59 0.12
60 0.13
61 0.11
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.3
68 0.38
69 0.46
70 0.53
71 0.62
72 0.69
73 0.69
74 0.7
75 0.75
76 0.77
77 0.79
78 0.79
79 0.81
80 0.78
81 0.82
82 0.81
83 0.82
84 0.77
85 0.76
86 0.78
87 0.78
88 0.8
89 0.77
90 0.78