Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A4X5

Protein Details
Accession A0A437A4X5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-93LFRLKEPGRSRKRHRAGIKKTKAYLBasic
NLS Segment(s)
PositionSequence
52-90SAKRRKIAGKKVGLAAALFRLKEPGRSRKRHRAGIKKTK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MVPAPNMLAQTNNNAASAGEWENSNSSHGFNPNGPFNFAPQVPKGESIHPESAKRRKIAGKKVGLAAALFRLKEPGRSRKRHRAGIKKTKAYLEADATEKERLLAEADMTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.19
5 0.15
6 0.11
7 0.11
8 0.12
9 0.13
10 0.13
11 0.14
12 0.12
13 0.11
14 0.13
15 0.15
16 0.16
17 0.18
18 0.21
19 0.25
20 0.25
21 0.26
22 0.24
23 0.24
24 0.25
25 0.23
26 0.22
27 0.17
28 0.2
29 0.19
30 0.21
31 0.21
32 0.2
33 0.22
34 0.24
35 0.29
36 0.27
37 0.29
38 0.33
39 0.39
40 0.41
41 0.39
42 0.38
43 0.4
44 0.46
45 0.52
46 0.55
47 0.53
48 0.51
49 0.51
50 0.48
51 0.41
52 0.34
53 0.24
54 0.19
55 0.15
56 0.12
57 0.11
58 0.13
59 0.13
60 0.2
61 0.26
62 0.34
63 0.42
64 0.51
65 0.61
66 0.68
67 0.76
68 0.79
69 0.83
70 0.83
71 0.85
72 0.87
73 0.88
74 0.84
75 0.8
76 0.74
77 0.67
78 0.6
79 0.53
80 0.46
81 0.39
82 0.34
83 0.32
84 0.31
85 0.28
86 0.25
87 0.21
88 0.17
89 0.15
90 0.14
91 0.13
92 0.12