Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A436ZUP7

Protein Details
Accession A0A436ZUP7    Localization Confidence High Confidence Score 22.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-22PPERTGPRKIIKLRLSPRHLAHydrophilic
30-59AATTSQKATEKPPKKDKKPKKSTSAAAAAAHydrophilic
72-96IIQLAPKPKESKKSKKQQVAATPAAHydrophilic
377-403GITPPMHWARRRRFRKRAVNRNMDKVEHydrophilic
NLS Segment(s)
PositionSequence
39-51EKPPKKDKKPKKS
78-87KPKESKKSKK
386-393RRRRFRKR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
CDD cd08047  TAF7  
Amino Acid Sequences MPPERTGPRKIIKLRLSPRHLAQFVDRPSAATTSQKATEKPPKKDKKPKKSTSAAAAAAAVDTKEPLPQKEIIQLAPKPKESKKSKKQQVAATPAAGGPETPIASSITLATPKPAGSGIKIKFNVNTLKNAAKENAAAAAPQTPSTPKAAAALTAQTITPAPITAPTTSSRPAGLSNLPPLQTKVGNQSPAVGTASTPSVPKIRLKASFSGLKSANAADTPKAQTPKTPIIKLKSNASRPTTTRRAVPIGYGYDSEAEDREEDPAIEEQFILRMPPGEDCEYLRSEIEKKEFGKSSDVWFKFKDDRRAIVGVRGRIYSATLVDLPCIIESNKTIDKGKNIFKTADISQMLLVGDRLIFEDQTLSNAIPNSLVNYPHGITPPMHWARRRRFRKRAVNRNMDKVEEAVEKLLAADAECESVDYELLTEADLTREADEKAGRNMMNYEMGEEDADGEIDMTYEEDGEGEEDEGDEHALDLMDFEGELTAMMDDTEHAQPEIKHAPAPISSDEDEDDDDDEEEEDNDGDAMDLDPGMSAEKLQLKEEMADLERAITVKTRERDGMHNQIVRQRIQNVIDGLKAELELKKSSLEGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.8
4 0.77
5 0.77
6 0.76
7 0.69
8 0.61
9 0.58
10 0.56
11 0.53
12 0.53
13 0.46
14 0.38
15 0.39
16 0.38
17 0.33
18 0.3
19 0.29
20 0.27
21 0.33
22 0.35
23 0.35
24 0.42
25 0.51
26 0.55
27 0.62
28 0.68
29 0.73
30 0.81
31 0.9
32 0.92
33 0.93
34 0.94
35 0.94
36 0.93
37 0.92
38 0.88
39 0.85
40 0.82
41 0.72
42 0.61
43 0.52
44 0.42
45 0.32
46 0.25
47 0.16
48 0.09
49 0.08
50 0.07
51 0.11
52 0.14
53 0.16
54 0.19
55 0.22
56 0.24
57 0.29
58 0.32
59 0.31
60 0.35
61 0.38
62 0.43
63 0.45
64 0.48
65 0.49
66 0.51
67 0.59
68 0.62
69 0.69
70 0.71
71 0.76
72 0.82
73 0.85
74 0.87
75 0.86
76 0.86
77 0.83
78 0.76
79 0.66
80 0.56
81 0.47
82 0.4
83 0.3
84 0.2
85 0.12
86 0.11
87 0.1
88 0.09
89 0.1
90 0.1
91 0.1
92 0.11
93 0.11
94 0.1
95 0.12
96 0.13
97 0.13
98 0.13
99 0.13
100 0.14
101 0.15
102 0.14
103 0.15
104 0.24
105 0.25
106 0.33
107 0.34
108 0.35
109 0.34
110 0.38
111 0.43
112 0.36
113 0.39
114 0.34
115 0.37
116 0.38
117 0.39
118 0.35
119 0.28
120 0.26
121 0.22
122 0.2
123 0.15
124 0.13
125 0.11
126 0.14
127 0.13
128 0.13
129 0.13
130 0.12
131 0.14
132 0.17
133 0.17
134 0.13
135 0.16
136 0.15
137 0.16
138 0.15
139 0.15
140 0.13
141 0.13
142 0.12
143 0.1
144 0.1
145 0.09
146 0.08
147 0.07
148 0.06
149 0.08
150 0.1
151 0.1
152 0.12
153 0.13
154 0.16
155 0.17
156 0.18
157 0.16
158 0.15
159 0.16
160 0.17
161 0.19
162 0.19
163 0.22
164 0.24
165 0.25
166 0.24
167 0.24
168 0.24
169 0.22
170 0.21
171 0.23
172 0.25
173 0.26
174 0.25
175 0.27
176 0.24
177 0.25
178 0.24
179 0.16
180 0.12
181 0.11
182 0.12
183 0.1
184 0.1
185 0.1
186 0.12
187 0.14
188 0.17
189 0.2
190 0.24
191 0.29
192 0.32
193 0.34
194 0.36
195 0.41
196 0.38
197 0.4
198 0.35
199 0.31
200 0.28
201 0.25
202 0.21
203 0.15
204 0.15
205 0.11
206 0.13
207 0.15
208 0.18
209 0.21
210 0.2
211 0.22
212 0.27
213 0.36
214 0.38
215 0.4
216 0.41
217 0.44
218 0.51
219 0.5
220 0.53
221 0.51
222 0.52
223 0.53
224 0.52
225 0.51
226 0.47
227 0.53
228 0.51
229 0.45
230 0.42
231 0.39
232 0.38
233 0.34
234 0.33
235 0.28
236 0.23
237 0.22
238 0.19
239 0.16
240 0.13
241 0.13
242 0.12
243 0.09
244 0.08
245 0.08
246 0.08
247 0.08
248 0.07
249 0.07
250 0.08
251 0.09
252 0.09
253 0.08
254 0.08
255 0.07
256 0.07
257 0.07
258 0.06
259 0.04
260 0.05
261 0.05
262 0.07
263 0.09
264 0.11
265 0.11
266 0.12
267 0.15
268 0.15
269 0.15
270 0.14
271 0.13
272 0.14
273 0.16
274 0.17
275 0.19
276 0.19
277 0.23
278 0.24
279 0.24
280 0.25
281 0.24
282 0.26
283 0.32
284 0.32
285 0.3
286 0.29
287 0.31
288 0.35
289 0.39
290 0.43
291 0.36
292 0.37
293 0.39
294 0.41
295 0.38
296 0.36
297 0.35
298 0.27
299 0.26
300 0.24
301 0.21
302 0.18
303 0.18
304 0.13
305 0.09
306 0.08
307 0.08
308 0.08
309 0.08
310 0.08
311 0.07
312 0.07
313 0.07
314 0.06
315 0.06
316 0.06
317 0.11
318 0.13
319 0.14
320 0.17
321 0.18
322 0.23
323 0.27
324 0.34
325 0.34
326 0.35
327 0.34
328 0.32
329 0.34
330 0.3
331 0.31
332 0.24
333 0.2
334 0.17
335 0.18
336 0.17
337 0.13
338 0.12
339 0.06
340 0.05
341 0.05
342 0.06
343 0.05
344 0.05
345 0.05
346 0.07
347 0.06
348 0.08
349 0.09
350 0.08
351 0.09
352 0.09
353 0.09
354 0.08
355 0.08
356 0.1
357 0.1
358 0.11
359 0.1
360 0.12
361 0.13
362 0.13
363 0.14
364 0.13
365 0.12
366 0.13
367 0.22
368 0.26
369 0.29
370 0.32
371 0.41
372 0.5
373 0.61
374 0.69
375 0.7
376 0.75
377 0.82
378 0.89
379 0.9
380 0.91
381 0.91
382 0.91
383 0.86
384 0.85
385 0.76
386 0.66
387 0.56
388 0.45
389 0.38
390 0.28
391 0.24
392 0.15
393 0.13
394 0.11
395 0.1
396 0.1
397 0.07
398 0.05
399 0.06
400 0.05
401 0.06
402 0.06
403 0.06
404 0.06
405 0.06
406 0.06
407 0.05
408 0.05
409 0.05
410 0.05
411 0.05
412 0.05
413 0.05
414 0.05
415 0.06
416 0.07
417 0.07
418 0.09
419 0.09
420 0.11
421 0.13
422 0.15
423 0.17
424 0.21
425 0.2
426 0.19
427 0.2
428 0.2
429 0.22
430 0.2
431 0.18
432 0.14
433 0.14
434 0.13
435 0.12
436 0.11
437 0.07
438 0.07
439 0.06
440 0.05
441 0.05
442 0.05
443 0.05
444 0.04
445 0.04
446 0.04
447 0.04
448 0.04
449 0.04
450 0.05
451 0.05
452 0.05
453 0.05
454 0.05
455 0.05
456 0.06
457 0.06
458 0.05
459 0.05
460 0.05
461 0.05
462 0.04
463 0.04
464 0.04
465 0.04
466 0.04
467 0.04
468 0.04
469 0.04
470 0.04
471 0.04
472 0.04
473 0.04
474 0.04
475 0.04
476 0.04
477 0.08
478 0.09
479 0.09
480 0.1
481 0.12
482 0.13
483 0.19
484 0.23
485 0.2
486 0.21
487 0.21
488 0.23
489 0.23
490 0.26
491 0.23
492 0.23
493 0.23
494 0.23
495 0.23
496 0.22
497 0.21
498 0.18
499 0.17
500 0.12
501 0.12
502 0.11
503 0.1
504 0.1
505 0.09
506 0.09
507 0.08
508 0.07
509 0.07
510 0.06
511 0.06
512 0.06
513 0.06
514 0.05
515 0.05
516 0.05
517 0.05
518 0.05
519 0.06
520 0.06
521 0.06
522 0.1
523 0.16
524 0.17
525 0.19
526 0.21
527 0.21
528 0.22
529 0.24
530 0.23
531 0.19
532 0.19
533 0.18
534 0.17
535 0.17
536 0.16
537 0.15
538 0.15
539 0.17
540 0.24
541 0.27
542 0.31
543 0.35
544 0.38
545 0.45
546 0.49
547 0.56
548 0.56
549 0.57
550 0.55
551 0.56
552 0.58
553 0.54
554 0.51
555 0.43
556 0.42
557 0.4
558 0.42
559 0.4
560 0.37
561 0.36
562 0.31
563 0.29
564 0.23
565 0.21
566 0.18
567 0.17
568 0.19
569 0.19
570 0.19
571 0.2
572 0.2