Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A436ZSP1

Protein Details
Accession A0A436ZSP1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-109VESHKLRGKGKPKKYKLGRERTAGKKKSKRKBasic
NLS Segment(s)
PositionSequence
83-109KLRGKGKPKKYKLGRERTAGKKKSKRK
Subcellular Location(s) mito 15.5, mito_nucl 14, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MATPRARILDLMRVSCRLFNTHFNPTGERTGNKILRERLKGPSLLQYYPKEQFSIKQFKRAFPDLSMSDEKEEIRLESVESHKLRGKGKPKKYKLGRERTAGKKKSKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.32
4 0.27
5 0.26
6 0.3
7 0.33
8 0.38
9 0.42
10 0.42
11 0.43
12 0.42
13 0.45
14 0.4
15 0.35
16 0.32
17 0.36
18 0.38
19 0.38
20 0.4
21 0.4
22 0.44
23 0.49
24 0.47
25 0.44
26 0.43
27 0.42
28 0.37
29 0.38
30 0.35
31 0.31
32 0.33
33 0.3
34 0.31
35 0.32
36 0.31
37 0.24
38 0.21
39 0.23
40 0.26
41 0.34
42 0.31
43 0.38
44 0.38
45 0.41
46 0.46
47 0.46
48 0.41
49 0.31
50 0.36
51 0.27
52 0.31
53 0.3
54 0.25
55 0.22
56 0.22
57 0.2
58 0.17
59 0.16
60 0.11
61 0.11
62 0.1
63 0.1
64 0.13
65 0.15
66 0.21
67 0.21
68 0.24
69 0.27
70 0.31
71 0.35
72 0.39
73 0.48
74 0.5
75 0.61
76 0.69
77 0.72
78 0.79
79 0.85
80 0.88
81 0.88
82 0.89
83 0.85
84 0.83
85 0.85
86 0.85
87 0.86
88 0.83
89 0.83