Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437ACH8

Protein Details
Accession A0A437ACH8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPPKKRTPAGPPPKKKPRVKLAQNLSLTHydrophilic
NLS Segment(s)
PositionSequence
3-20PKKRTPAGPPPKKKPRVK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
Pfam View protein in Pfam  
PF13833  EF-hand_8  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
Amino Acid Sequences MPPKKRTPAGPPPKKKPRVKLAQNLSLTTEEEQEVRTAFGYFTDPEELGNDVIQSKSLKKVFSALGFNLSSGEVRDILKTIDPDDEGFITYELFLEVAAMKIKDRDKKEEVNKAFSLFTGGDDEGPITLQHLRKVAKVLNENVSDDTLKDMLREASASGGMDVNKRDFEDVMKRAGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.89
4 0.89
5 0.89
6 0.89
7 0.88
8 0.86
9 0.85
10 0.79
11 0.7
12 0.62
13 0.53
14 0.44
15 0.34
16 0.27
17 0.18
18 0.16
19 0.15
20 0.13
21 0.12
22 0.11
23 0.1
24 0.09
25 0.08
26 0.09
27 0.1
28 0.1
29 0.12
30 0.14
31 0.13
32 0.12
33 0.14
34 0.14
35 0.12
36 0.11
37 0.09
38 0.08
39 0.08
40 0.09
41 0.09
42 0.1
43 0.16
44 0.18
45 0.18
46 0.18
47 0.22
48 0.23
49 0.25
50 0.27
51 0.21
52 0.23
53 0.22
54 0.22
55 0.19
56 0.16
57 0.13
58 0.1
59 0.1
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.05
87 0.05
88 0.09
89 0.13
90 0.2
91 0.23
92 0.29
93 0.33
94 0.42
95 0.49
96 0.56
97 0.55
98 0.54
99 0.52
100 0.47
101 0.42
102 0.33
103 0.28
104 0.18
105 0.16
106 0.13
107 0.12
108 0.11
109 0.11
110 0.11
111 0.08
112 0.08
113 0.07
114 0.06
115 0.1
116 0.11
117 0.14
118 0.18
119 0.2
120 0.21
121 0.25
122 0.27
123 0.3
124 0.34
125 0.36
126 0.39
127 0.39
128 0.39
129 0.36
130 0.35
131 0.28
132 0.23
133 0.21
134 0.15
135 0.13
136 0.12
137 0.12
138 0.12
139 0.12
140 0.12
141 0.1
142 0.1
143 0.11
144 0.11
145 0.1
146 0.12
147 0.12
148 0.14
149 0.16
150 0.17
151 0.18
152 0.19
153 0.19
154 0.18
155 0.22
156 0.29
157 0.29
158 0.31