Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437A2U3

Protein Details
Accession A0A437A2U3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
137-178GKPPKKGGEKPKDGEKPKKEEKKEEKKEEKKEEKKEEKKKEQBasic
NLS Segment(s)
PositionSequence
137-178GKPPKKGGEKPKDGEKPKKEEKKEEKKEEKKEEKKEEKKKEQ
Subcellular Location(s) cyto 8.5, E.R. 7, cyto_nucl 5, mito 4, extr 4
Family & Domain DBs
Amino Acid Sequences MQLLTIAAVLAAAGSALAVPAPAPTKAPILINPLVGRAVCQTTHLSTTGPGIFGFLGIGRGVHTKYETTTTVVQTADLNCNGCALHMKFENREYRFPGVVRGPVITEAKATKTVTDKVRTVTQWVCKTSPGPVAPVGKPPKKGGEKPKDGEKPKKEEKKEEKKEEKKEEKKEEKKKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.05
8 0.07
9 0.07
10 0.09
11 0.11
12 0.13
13 0.15
14 0.17
15 0.17
16 0.22
17 0.24
18 0.25
19 0.24
20 0.23
21 0.22
22 0.2
23 0.18
24 0.14
25 0.15
26 0.11
27 0.13
28 0.15
29 0.16
30 0.18
31 0.17
32 0.15
33 0.14
34 0.17
35 0.15
36 0.14
37 0.12
38 0.1
39 0.1
40 0.09
41 0.09
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.07
48 0.07
49 0.08
50 0.09
51 0.09
52 0.1
53 0.13
54 0.13
55 0.14
56 0.17
57 0.17
58 0.18
59 0.17
60 0.16
61 0.15
62 0.15
63 0.14
64 0.12
65 0.13
66 0.11
67 0.11
68 0.1
69 0.09
70 0.11
71 0.1
72 0.12
73 0.14
74 0.15
75 0.16
76 0.21
77 0.28
78 0.27
79 0.29
80 0.3
81 0.3
82 0.3
83 0.29
84 0.28
85 0.22
86 0.22
87 0.2
88 0.17
89 0.14
90 0.15
91 0.16
92 0.12
93 0.12
94 0.11
95 0.12
96 0.15
97 0.14
98 0.13
99 0.16
100 0.22
101 0.26
102 0.29
103 0.29
104 0.29
105 0.34
106 0.33
107 0.34
108 0.33
109 0.36
110 0.37
111 0.39
112 0.37
113 0.34
114 0.34
115 0.33
116 0.35
117 0.27
118 0.24
119 0.25
120 0.29
121 0.29
122 0.37
123 0.42
124 0.4
125 0.42
126 0.43
127 0.48
128 0.51
129 0.59
130 0.61
131 0.63
132 0.68
133 0.7
134 0.77
135 0.77
136 0.78
137 0.8
138 0.77
139 0.76
140 0.77
141 0.83
142 0.8
143 0.81
144 0.84
145 0.85
146 0.87
147 0.89
148 0.9
149 0.89
150 0.93
151 0.93
152 0.93
153 0.92
154 0.91
155 0.91
156 0.91
157 0.92
158 0.92