Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427XMJ8

Protein Details
Accession A0A427XMJ8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
153-177PDPLSPIPAKRRRPRARARPRSASAHydrophilic
NLS Segment(s)
PositionSequence
160-174PAKRRRPRARARPRS
392-399RPGRRRRR
Subcellular Location(s) nucl 13, cyto 10, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MDLHFATPGLAKAVSTIDRYGASTVPGSRSSSAALDTDTSLLPTTPLLSPQPSPLVLSSPSTPAMTVDASPRHEATPLVSDLELESAILRGVAAHRPVGPHKHVLMIALQSDVHEETGIWVPVGKLWDDLRALYDLDALDGMSSSTPSLPASPDPLSPIPAKRRRPRARARPRSASAASASSLSSPSPSPSPSPSRSGSPGPSRSRSAWVIDSAHFARPFELPGIGQWRHDVNGTGNGHGHGHGNGTASAAASTSGGAVTPSESDDEDEFMDLVYARAVGDEEGEEWEAGVKAQLARTEAAAAAAAAATPAATGGGKKGGRANKSASASGSRRTSGAGVEPDTSPLSSDAEPPATTTTTRRKSTTAKGKAAAAAAANKRARSSVGDTDEDERPGRRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.18
5 0.19
6 0.21
7 0.21
8 0.18
9 0.17
10 0.17
11 0.19
12 0.21
13 0.23
14 0.24
15 0.24
16 0.24
17 0.24
18 0.22
19 0.21
20 0.18
21 0.17
22 0.15
23 0.15
24 0.16
25 0.14
26 0.13
27 0.12
28 0.11
29 0.1
30 0.09
31 0.11
32 0.1
33 0.13
34 0.15
35 0.17
36 0.18
37 0.22
38 0.25
39 0.23
40 0.24
41 0.22
42 0.22
43 0.21
44 0.22
45 0.2
46 0.19
47 0.2
48 0.19
49 0.18
50 0.15
51 0.16
52 0.14
53 0.14
54 0.17
55 0.19
56 0.22
57 0.25
58 0.25
59 0.24
60 0.23
61 0.22
62 0.2
63 0.21
64 0.19
65 0.18
66 0.17
67 0.16
68 0.16
69 0.16
70 0.13
71 0.08
72 0.07
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.06
79 0.1
80 0.11
81 0.12
82 0.14
83 0.17
84 0.21
85 0.27
86 0.29
87 0.3
88 0.3
89 0.31
90 0.3
91 0.29
92 0.27
93 0.21
94 0.19
95 0.15
96 0.14
97 0.1
98 0.12
99 0.11
100 0.09
101 0.07
102 0.06
103 0.08
104 0.11
105 0.11
106 0.09
107 0.09
108 0.09
109 0.11
110 0.12
111 0.1
112 0.1
113 0.1
114 0.13
115 0.13
116 0.14
117 0.13
118 0.13
119 0.13
120 0.11
121 0.12
122 0.09
123 0.08
124 0.08
125 0.06
126 0.05
127 0.05
128 0.05
129 0.03
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.07
137 0.08
138 0.12
139 0.13
140 0.13
141 0.16
142 0.17
143 0.19
144 0.2
145 0.24
146 0.3
147 0.38
148 0.47
149 0.51
150 0.62
151 0.69
152 0.77
153 0.82
154 0.83
155 0.87
156 0.89
157 0.88
158 0.86
159 0.79
160 0.76
161 0.66
162 0.57
163 0.47
164 0.36
165 0.29
166 0.2
167 0.18
168 0.11
169 0.11
170 0.08
171 0.08
172 0.07
173 0.08
174 0.08
175 0.09
176 0.11
177 0.15
178 0.21
179 0.22
180 0.27
181 0.27
182 0.28
183 0.3
184 0.31
185 0.31
186 0.32
187 0.37
188 0.37
189 0.39
190 0.39
191 0.37
192 0.39
193 0.36
194 0.32
195 0.25
196 0.23
197 0.22
198 0.2
199 0.22
200 0.19
201 0.21
202 0.18
203 0.17
204 0.16
205 0.14
206 0.15
207 0.12
208 0.11
209 0.08
210 0.09
211 0.15
212 0.15
213 0.14
214 0.15
215 0.15
216 0.15
217 0.16
218 0.15
219 0.1
220 0.18
221 0.18
222 0.18
223 0.18
224 0.18
225 0.17
226 0.17
227 0.16
228 0.08
229 0.09
230 0.09
231 0.09
232 0.09
233 0.09
234 0.09
235 0.08
236 0.07
237 0.06
238 0.06
239 0.05
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.06
250 0.06
251 0.08
252 0.08
253 0.09
254 0.09
255 0.09
256 0.08
257 0.07
258 0.07
259 0.06
260 0.05
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.05
268 0.05
269 0.05
270 0.07
271 0.07
272 0.07
273 0.06
274 0.07
275 0.07
276 0.07
277 0.06
278 0.07
279 0.07
280 0.09
281 0.11
282 0.12
283 0.12
284 0.13
285 0.13
286 0.12
287 0.11
288 0.09
289 0.08
290 0.06
291 0.05
292 0.05
293 0.03
294 0.03
295 0.03
296 0.02
297 0.02
298 0.03
299 0.03
300 0.04
301 0.05
302 0.12
303 0.13
304 0.15
305 0.22
306 0.28
307 0.31
308 0.35
309 0.39
310 0.39
311 0.43
312 0.43
313 0.39
314 0.4
315 0.39
316 0.41
317 0.39
318 0.33
319 0.29
320 0.29
321 0.28
322 0.22
323 0.25
324 0.23
325 0.21
326 0.23
327 0.23
328 0.23
329 0.23
330 0.21
331 0.17
332 0.14
333 0.15
334 0.14
335 0.16
336 0.17
337 0.19
338 0.19
339 0.19
340 0.21
341 0.19
342 0.2
343 0.24
344 0.32
345 0.38
346 0.42
347 0.43
348 0.46
349 0.52
350 0.62
351 0.66
352 0.66
353 0.64
354 0.63
355 0.63
356 0.61
357 0.54
358 0.45
359 0.37
360 0.35
361 0.31
362 0.37
363 0.36
364 0.34
365 0.34
366 0.34
367 0.33
368 0.31
369 0.34
370 0.35
371 0.38
372 0.4
373 0.41
374 0.44
375 0.45
376 0.42
377 0.37
378 0.32
379 0.34