Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427XEW3

Protein Details
Accession A0A427XEW3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-95RSPPRRVRVRLERKRNDDEGBasic
NLS Segment(s)
PositionSequence
77-89SPPRRVRVRLERK
Subcellular Location(s) mito 10.5, mito_nucl 10.5, nucl 9.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR020052  Ribosomal_L31e_CS  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
PROSITE View protein in PROSITE  
PS01144  RIBOSOMAL_L31E  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MQAPTQKTRKQRSALQDVVTREYTINVHKRTHDLSFKSKAPKAVKAVTEFAQKAMGVKDVRISPGLNQAIWARGVRSPPRRVRVRLERKRNDDEGAKEKLYVVASVVEGVTSFKGLETVVVEGDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.69
3 0.65
4 0.59
5 0.57
6 0.49
7 0.41
8 0.31
9 0.26
10 0.23
11 0.26
12 0.31
13 0.3
14 0.31
15 0.32
16 0.36
17 0.38
18 0.42
19 0.42
20 0.39
21 0.43
22 0.45
23 0.49
24 0.52
25 0.51
26 0.52
27 0.49
28 0.5
29 0.48
30 0.48
31 0.46
32 0.42
33 0.43
34 0.37
35 0.39
36 0.32
37 0.27
38 0.23
39 0.2
40 0.17
41 0.15
42 0.17
43 0.11
44 0.11
45 0.14
46 0.13
47 0.14
48 0.14
49 0.14
50 0.1
51 0.18
52 0.18
53 0.15
54 0.16
55 0.15
56 0.15
57 0.16
58 0.15
59 0.09
60 0.1
61 0.14
62 0.21
63 0.28
64 0.36
65 0.42
66 0.51
67 0.56
68 0.59
69 0.64
70 0.68
71 0.72
72 0.74
73 0.78
74 0.78
75 0.79
76 0.82
77 0.76
78 0.69
79 0.63
80 0.59
81 0.54
82 0.5
83 0.43
84 0.36
85 0.33
86 0.32
87 0.27
88 0.2
89 0.15
90 0.11
91 0.11
92 0.11
93 0.11
94 0.08
95 0.07
96 0.08
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.08
104 0.08
105 0.09
106 0.09