Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427YA14

Protein Details
Accession A0A427YA14    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-43AQAGSKAGKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
18-37QAGSKAGKKKKWSKGKVKDK
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MSLPPQVKSKAQKALAAQAGSKAGKKKKWSKGKVKDKANNAVVLDKQTYDRILKEVPTYKLISQSVLIDRMKVNGSLARRAIAFLEKEGLIKRVVHHNAQLIYTRAIVAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.47
4 0.4
5 0.33
6 0.34
7 0.3
8 0.31
9 0.3
10 0.31
11 0.36
12 0.45
13 0.53
14 0.59
15 0.69
16 0.76
17 0.8
18 0.85
19 0.9
20 0.9
21 0.9
22 0.87
23 0.83
24 0.82
25 0.73
26 0.65
27 0.54
28 0.47
29 0.37
30 0.32
31 0.25
32 0.17
33 0.15
34 0.13
35 0.14
36 0.13
37 0.12
38 0.12
39 0.13
40 0.13
41 0.16
42 0.2
43 0.2
44 0.21
45 0.23
46 0.21
47 0.25
48 0.24
49 0.21
50 0.17
51 0.17
52 0.16
53 0.19
54 0.18
55 0.15
56 0.15
57 0.16
58 0.16
59 0.14
60 0.14
61 0.13
62 0.15
63 0.18
64 0.19
65 0.18
66 0.17
67 0.17
68 0.17
69 0.18
70 0.17
71 0.13
72 0.15
73 0.14
74 0.16
75 0.17
76 0.17
77 0.15
78 0.15
79 0.17
80 0.24
81 0.28
82 0.3
83 0.32
84 0.36
85 0.37
86 0.37
87 0.38
88 0.31
89 0.29
90 0.26
91 0.24