Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427Y0V7

Protein Details
Accession A0A427Y0V7   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-46ASTIPIVKKRTKAFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-46KKRTKAFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKG
Subcellular Location(s) mito 13, cyto 10, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASTIPIVKKRTKAFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPKIGYGSNAKTRHLIPSGHKELLVNNVADLNLLLMHSGKYAAVVAHGVSSKKRIEIVQRAKILGVKVTNAAAKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.85
4 0.87
5 0.87
6 0.85
7 0.82
8 0.81
9 0.77
10 0.7
11 0.61
12 0.55
13 0.55
14 0.56
15 0.58
16 0.59
17 0.55
18 0.52
19 0.53
20 0.58
21 0.61
22 0.62
23 0.62
24 0.63
25 0.71
26 0.8
27 0.84
28 0.77
29 0.74
30 0.71
31 0.68
32 0.67
33 0.64
34 0.64
35 0.64
36 0.65
37 0.59
38 0.52
39 0.46
40 0.35
41 0.31
42 0.24
43 0.22
44 0.26
45 0.26
46 0.26
47 0.27
48 0.27
49 0.27
50 0.26
51 0.25
52 0.2
53 0.28
54 0.32
55 0.31
56 0.3
57 0.27
58 0.25
59 0.27
60 0.25
61 0.16
62 0.11
63 0.12
64 0.11
65 0.11
66 0.1
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.07
83 0.09
84 0.1
85 0.1
86 0.14
87 0.15
88 0.16
89 0.18
90 0.19
91 0.27
92 0.37
93 0.46
94 0.5
95 0.52
96 0.52
97 0.5
98 0.5
99 0.42
100 0.36
101 0.28
102 0.21
103 0.2
104 0.22
105 0.22
106 0.21
107 0.22
108 0.19
109 0.19