Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427Y6T9

Protein Details
Accession A0A427Y6T9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-124EATASSPKTTRNKKVKQEKVKQERTPETEMHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 26
Family & Domain DBs
Amino Acid Sequences MSTEYKKGDHPWKEEHSTIIAEGIINLIMAHRSDLYRLPGIAGIVDGHGNDRTSRKIKQMATQCAKTLGVSEDLVKSAKASSTGQRGRKRTSDGEATASSPKTTRNKKVKQEKVKQERTPETEME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.53
3 0.46
4 0.39
5 0.34
6 0.26
7 0.19
8 0.13
9 0.12
10 0.1
11 0.07
12 0.05
13 0.05
14 0.04
15 0.05
16 0.05
17 0.06
18 0.06
19 0.07
20 0.08
21 0.11
22 0.14
23 0.15
24 0.15
25 0.15
26 0.14
27 0.14
28 0.13
29 0.1
30 0.07
31 0.06
32 0.06
33 0.05
34 0.06
35 0.06
36 0.07
37 0.08
38 0.09
39 0.14
40 0.17
41 0.19
42 0.23
43 0.29
44 0.31
45 0.36
46 0.43
47 0.49
48 0.5
49 0.49
50 0.45
51 0.4
52 0.38
53 0.31
54 0.23
55 0.14
56 0.11
57 0.1
58 0.11
59 0.1
60 0.1
61 0.11
62 0.09
63 0.08
64 0.07
65 0.07
66 0.09
67 0.1
68 0.14
69 0.23
70 0.3
71 0.39
72 0.46
73 0.5
74 0.53
75 0.56
76 0.58
77 0.53
78 0.52
79 0.51
80 0.45
81 0.45
82 0.4
83 0.38
84 0.36
85 0.32
86 0.27
87 0.2
88 0.25
89 0.3
90 0.38
91 0.46
92 0.54
93 0.63
94 0.73
95 0.83
96 0.87
97 0.89
98 0.91
99 0.92
100 0.92
101 0.93
102 0.89
103 0.88
104 0.86
105 0.81