Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427XSU8

Protein Details
Accession A0A427XSU8   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
187-208GKGSRGKKGGRGRGRGRSKKMKBasic
NLS Segment(s)
PositionSequence
184-208GSHGKGSRGKKGGRGRGRGRSKKMK
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
Amino Acid Sequences MGLFDFLPCCGRRSVEDKDDEPTDTDPLLAPVRRGAESITSQEGYGAVSMSASDSGGLSGAQRARIAEIGREVGNHMLPINQASRAATTSPSARVPSTSGGVRPPSPDSTSSPSRPTTPSPAHGDGEYGSGSGVLSPPEDDAESSSRHNRSGAATPADGASAAVDADGVVHKTLFHGSNPNNRGSHGKGSRGKKGGRGRGRGRSKKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.45
4 0.44
5 0.47
6 0.47
7 0.43
8 0.39
9 0.32
10 0.26
11 0.2
12 0.19
13 0.15
14 0.15
15 0.19
16 0.17
17 0.16
18 0.18
19 0.2
20 0.2
21 0.2
22 0.19
23 0.19
24 0.21
25 0.24
26 0.24
27 0.22
28 0.21
29 0.21
30 0.2
31 0.15
32 0.13
33 0.09
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.04
46 0.08
47 0.09
48 0.1
49 0.1
50 0.1
51 0.11
52 0.14
53 0.14
54 0.12
55 0.13
56 0.14
57 0.13
58 0.13
59 0.13
60 0.12
61 0.11
62 0.1
63 0.08
64 0.07
65 0.07
66 0.09
67 0.09
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.1
74 0.09
75 0.09
76 0.11
77 0.12
78 0.13
79 0.13
80 0.13
81 0.13
82 0.13
83 0.13
84 0.14
85 0.13
86 0.12
87 0.13
88 0.15
89 0.15
90 0.15
91 0.16
92 0.16
93 0.17
94 0.18
95 0.19
96 0.23
97 0.27
98 0.28
99 0.28
100 0.27
101 0.28
102 0.29
103 0.28
104 0.3
105 0.28
106 0.3
107 0.34
108 0.35
109 0.34
110 0.31
111 0.29
112 0.22
113 0.21
114 0.16
115 0.1
116 0.07
117 0.06
118 0.06
119 0.05
120 0.05
121 0.04
122 0.04
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.08
129 0.1
130 0.11
131 0.14
132 0.2
133 0.2
134 0.21
135 0.21
136 0.2
137 0.22
138 0.26
139 0.29
140 0.26
141 0.25
142 0.25
143 0.24
144 0.23
145 0.19
146 0.13
147 0.08
148 0.05
149 0.04
150 0.04
151 0.03
152 0.03
153 0.04
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.07
160 0.11
161 0.12
162 0.13
163 0.21
164 0.26
165 0.36
166 0.39
167 0.43
168 0.4
169 0.41
170 0.44
171 0.41
172 0.46
173 0.41
174 0.48
175 0.51
176 0.57
177 0.64
178 0.67
179 0.65
180 0.64
181 0.69
182 0.7
183 0.72
184 0.76
185 0.75
186 0.78
187 0.86
188 0.87