Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427XDK8

Protein Details
Accession A0A427XDK8   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-78QLAKWCPKVEKQEKKKTPKGRAKKRAQYTRRFVNVTHydrophilic
NLS Segment(s)
PositionSequence
53-68KQEKKKTPKGRAKKRA
Subcellular Location(s) mito 16, nucl 7, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MRPDPVENAAPNAGWSRGCWGVGVGDGWLRAKLSRRRLLLIQQLAKWCPKVEKQEKKKTPKGRAKKRAQYTRRFVNVTLTPGGKRSMNQQPAGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.16
5 0.16
6 0.15
7 0.13
8 0.12
9 0.13
10 0.12
11 0.08
12 0.07
13 0.08
14 0.08
15 0.08
16 0.08
17 0.09
18 0.17
19 0.23
20 0.32
21 0.38
22 0.4
23 0.43
24 0.45
25 0.49
26 0.5
27 0.49
28 0.43
29 0.39
30 0.39
31 0.37
32 0.36
33 0.3
34 0.22
35 0.18
36 0.2
37 0.28
38 0.36
39 0.46
40 0.55
41 0.65
42 0.74
43 0.8
44 0.85
45 0.84
46 0.84
47 0.84
48 0.85
49 0.86
50 0.87
51 0.89
52 0.9
53 0.91
54 0.91
55 0.89
56 0.88
57 0.85
58 0.84
59 0.8
60 0.72
61 0.62
62 0.59
63 0.54
64 0.48
65 0.43
66 0.35
67 0.29
68 0.29
69 0.31
70 0.24
71 0.21
72 0.25
73 0.32
74 0.37
75 0.43
76 0.47