Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427Y947

Protein Details
Accession A0A427Y947   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-29AAEAANPAARRPRKRRRRQASYDTDSDSHydrophilic
NLS Segment(s)
PositionSequence
10-19ARRPRKRRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAAEAANPAARRPRKRRRRQASYDTDSDSASSSSDSDDDSDKEDDKKDSKMDVDGASSSAASSSSDSSSDSSSDSSDSDSSDSDSDDDVKPAPKKAAPQRPRQPTLSPSPPPRTIPSFLPTAGAAEEDDRRARFKRIYMDRLVEGFGGDLEDLRKADPTLGPARLQLLIDSLAAGVDVFAEPATGGVDEVGVILNDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.81
3 0.9
4 0.91
5 0.94
6 0.94
7 0.94
8 0.94
9 0.9
10 0.84
11 0.77
12 0.66
13 0.56
14 0.46
15 0.36
16 0.25
17 0.18
18 0.13
19 0.09
20 0.09
21 0.09
22 0.09
23 0.09
24 0.11
25 0.12
26 0.14
27 0.16
28 0.17
29 0.18
30 0.2
31 0.23
32 0.23
33 0.26
34 0.24
35 0.25
36 0.25
37 0.25
38 0.25
39 0.22
40 0.21
41 0.18
42 0.17
43 0.14
44 0.13
45 0.1
46 0.07
47 0.07
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.1
73 0.09
74 0.1
75 0.09
76 0.13
77 0.14
78 0.14
79 0.16
80 0.15
81 0.22
82 0.3
83 0.41
84 0.43
85 0.52
86 0.6
87 0.67
88 0.69
89 0.66
90 0.59
91 0.53
92 0.54
93 0.51
94 0.47
95 0.45
96 0.47
97 0.46
98 0.46
99 0.45
100 0.41
101 0.36
102 0.34
103 0.3
104 0.26
105 0.24
106 0.23
107 0.19
108 0.15
109 0.13
110 0.1
111 0.08
112 0.08
113 0.09
114 0.09
115 0.11
116 0.11
117 0.14
118 0.16
119 0.2
120 0.21
121 0.24
122 0.33
123 0.39
124 0.45
125 0.47
126 0.49
127 0.46
128 0.44
129 0.41
130 0.31
131 0.22
132 0.16
133 0.11
134 0.08
135 0.06
136 0.05
137 0.05
138 0.07
139 0.07
140 0.07
141 0.08
142 0.08
143 0.1
144 0.11
145 0.16
146 0.2
147 0.22
148 0.22
149 0.22
150 0.24
151 0.23
152 0.22
153 0.17
154 0.13
155 0.12
156 0.11
157 0.11
158 0.09
159 0.07
160 0.07
161 0.06
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.06
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.04