Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427XHG2

Protein Details
Accession A0A427XHG2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
383-410EAVGKKPKVKWAEKERREREERKRIAATBasic
NLS Segment(s)
PositionSequence
369-406AQRRARGVKPNKPGEAVGKKPKVKWAEKERREREERKR
Subcellular Location(s) cyto 11, nucl 9, extr 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039146  GPANK1  
Amino Acid Sequences MDDGPRRTGIGFFPEAVVIRAGPSRPQPAPYDADDGEYPTPYSVNTNASAGPSRPPPPRLTQGRDSWSLWKDWHTNPSGHGGRRGPPVFVPATQTYDELGRSVLDGFGVDVDAGEVEKKDEGERQEAGGVADWYRSLSAGKSKTEVKPITAPTVPSPPQPTASTIVTTTSSTTQTPAPLRVPRSEWFIRRALANSASASSSTPTSRPSTPSSIGSMLGNIDTANPKVAPAPRVRYALGPDNVGYTRLEALGWGGGGLGRPEGWEEREAEVKRERDETPTRPRPRSPPNSSGSGSATPIDLTGDTDSDSDSPSGAISIPVSDDDDDDDNAPRGPGRTAPIATALKLDRLGLGRSRAEKKVTHTAAEIASAQRRARGVKPNKPGEAVGKKPKVKWAEKERREREERKRIAATLNAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.2
5 0.13
6 0.13
7 0.15
8 0.15
9 0.18
10 0.23
11 0.29
12 0.3
13 0.34
14 0.36
15 0.38
16 0.42
17 0.41
18 0.42
19 0.35
20 0.36
21 0.33
22 0.32
23 0.28
24 0.25
25 0.21
26 0.15
27 0.15
28 0.12
29 0.15
30 0.14
31 0.17
32 0.17
33 0.18
34 0.19
35 0.21
36 0.23
37 0.21
38 0.23
39 0.25
40 0.29
41 0.34
42 0.37
43 0.4
44 0.44
45 0.53
46 0.58
47 0.6
48 0.62
49 0.64
50 0.65
51 0.65
52 0.6
53 0.57
54 0.5
55 0.45
56 0.39
57 0.37
58 0.37
59 0.37
60 0.42
61 0.38
62 0.38
63 0.37
64 0.45
65 0.45
66 0.41
67 0.44
68 0.39
69 0.4
70 0.48
71 0.47
72 0.39
73 0.34
74 0.37
75 0.32
76 0.3
77 0.31
78 0.24
79 0.27
80 0.26
81 0.26
82 0.22
83 0.21
84 0.2
85 0.15
86 0.13
87 0.09
88 0.09
89 0.09
90 0.08
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.06
106 0.08
107 0.12
108 0.14
109 0.18
110 0.19
111 0.19
112 0.19
113 0.19
114 0.18
115 0.15
116 0.14
117 0.1
118 0.09
119 0.08
120 0.08
121 0.07
122 0.07
123 0.06
124 0.07
125 0.14
126 0.17
127 0.18
128 0.21
129 0.26
130 0.28
131 0.36
132 0.36
133 0.32
134 0.35
135 0.35
136 0.37
137 0.33
138 0.32
139 0.26
140 0.32
141 0.29
142 0.26
143 0.28
144 0.24
145 0.26
146 0.26
147 0.26
148 0.23
149 0.23
150 0.21
151 0.18
152 0.18
153 0.16
154 0.15
155 0.14
156 0.12
157 0.12
158 0.11
159 0.12
160 0.12
161 0.15
162 0.16
163 0.18
164 0.2
165 0.23
166 0.25
167 0.26
168 0.29
169 0.27
170 0.33
171 0.34
172 0.33
173 0.33
174 0.32
175 0.31
176 0.28
177 0.28
178 0.24
179 0.21
180 0.19
181 0.15
182 0.14
183 0.13
184 0.12
185 0.11
186 0.09
187 0.09
188 0.08
189 0.08
190 0.1
191 0.13
192 0.14
193 0.17
194 0.2
195 0.24
196 0.25
197 0.26
198 0.25
199 0.23
200 0.22
201 0.19
202 0.15
203 0.11
204 0.09
205 0.08
206 0.05
207 0.05
208 0.06
209 0.06
210 0.07
211 0.06
212 0.06
213 0.09
214 0.12
215 0.15
216 0.18
217 0.23
218 0.26
219 0.28
220 0.29
221 0.27
222 0.28
223 0.32
224 0.29
225 0.25
226 0.21
227 0.21
228 0.21
229 0.2
230 0.17
231 0.1
232 0.09
233 0.09
234 0.08
235 0.06
236 0.06
237 0.06
238 0.05
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.05
248 0.07
249 0.08
250 0.1
251 0.12
252 0.13
253 0.2
254 0.21
255 0.23
256 0.28
257 0.29
258 0.29
259 0.31
260 0.3
261 0.3
262 0.37
263 0.4
264 0.45
265 0.54
266 0.6
267 0.6
268 0.64
269 0.66
270 0.7
271 0.73
272 0.7
273 0.68
274 0.65
275 0.66
276 0.62
277 0.56
278 0.49
279 0.39
280 0.32
281 0.24
282 0.2
283 0.14
284 0.13
285 0.11
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.08
292 0.09
293 0.08
294 0.09
295 0.08
296 0.07
297 0.07
298 0.06
299 0.07
300 0.06
301 0.06
302 0.05
303 0.06
304 0.06
305 0.07
306 0.08
307 0.08
308 0.08
309 0.1
310 0.11
311 0.12
312 0.12
313 0.13
314 0.13
315 0.13
316 0.13
317 0.11
318 0.11
319 0.12
320 0.14
321 0.16
322 0.2
323 0.21
324 0.22
325 0.28
326 0.28
327 0.27
328 0.28
329 0.25
330 0.22
331 0.22
332 0.21
333 0.17
334 0.18
335 0.2
336 0.2
337 0.24
338 0.27
339 0.33
340 0.39
341 0.4
342 0.42
343 0.43
344 0.46
345 0.52
346 0.5
347 0.45
348 0.41
349 0.4
350 0.36
351 0.35
352 0.3
353 0.22
354 0.24
355 0.27
356 0.25
357 0.25
358 0.27
359 0.3
360 0.35
361 0.42
362 0.48
363 0.53
364 0.63
365 0.69
366 0.7
367 0.68
368 0.64
369 0.64
370 0.63
371 0.62
372 0.63
373 0.63
374 0.65
375 0.65
376 0.71
377 0.7
378 0.69
379 0.71
380 0.72
381 0.74
382 0.79
383 0.87
384 0.87
385 0.88
386 0.89
387 0.88
388 0.88
389 0.88
390 0.85
391 0.83
392 0.79
393 0.72
394 0.69